Recombinant Treponema pallidum Uncharacterized protein TP_0260 (TP_0260)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TP_0260; Uncharacterized protein TP_0260
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0260
Target Protein Sequence
MCYYRYVQVHSIWRRFCALGLLVPFLLLLFSCTNTVGYGVLQWSLPDLGLSTGDILPVYV RSNVSQVYIVEIQKKKVELPFWQLKLCRTKKEALQYAERLREYRYSYATSVLDGLPLREG PENTAPQVYRLREGQAVKLLWKGTGKAVYRGENRLEGDWFKVMTEDGTTGWCFSHGLSLF DERESRPTVRETDDLARDRDLQHVLNSAWYPEYYRTMVEQRRIDLEKMASGWGLFVGEKK GLARIELPDAHYAFPYSRLVKTGSNGYLFDGSSLSIYVRDAHTLAAQFTDEAGRLRIERF VTLEKTPEEIIAEEQLRRSALLEHVCTPGLRLHSEIYGTLSFTERNVFTWTGARALSPAL IPAGAGSTGRVALRCFIDQSLKSEYEGVLSFDFDSAQEWVHFLYLRTPGGLKLEHIDSTH LKDATVLRRSVSPVVLYFAPEGHAEPQP
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0260

STRING: 243276.TP0260

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is TP_0260 and what experimental approaches can be used to characterize its function?

TP_0260 is an uncharacterized protein encoded by the Treponema pallidum genome. To characterize its function, researchers should employ a multi-faceted approach combining bioinformatic analysis, recombinant protein expression, and functional assays. Begin with sequence homology analysis to identify potential structural or functional domains. Express the recombinant protein using a suitable expression system (E. coli, yeast, or mammalian cells) with appropriate tags for purification. Assess protein-protein interactions using co-immunoprecipitation or yeast two-hybrid systems. Evaluate immunoreactivity by testing against sera from infected animals and humans, similar to approaches used for other T. pallidum antigens . For functional studies, consider developing genetic manipulation techniques as recently demonstrated for T. pallidum genes, where researchers successfully replaced the tprA (tp0009) pseudogene with a kanamycin resistance cassette .

How does TP_0260 compare to other characterized T. pallidum proteins, and what can we infer about its potential role?

While specific comparative data for TP_0260 is limited, researchers should consider analyzing its properties in relation to well-characterized T. pallidum proteins such as TpN15, TpN17, and TpN47. These immunodominant lipoproteins have been extensively studied for their roles in pathogenesis and diagnostic applications . Examine sequence conservation across T. pallidum strains and subspecies, as high conservation (similar to TpN15) might indicate functional importance . Analyze expression patterns during different stages of infection, as differential expression may suggest stage-specific roles. Recent proteome-scale studies have identified numerous antigens with varying immunoreactivity profiles during infection progression . Consider whether TP_0260 shares properties with proteins that elicit early immune responses (like Tp0772) or those with sustained reactivity throughout infection.

What experimental design principles should I follow when investigating TP_0260 function?

Design robust experiments following these key principles: First, clearly define your research questions and formulate specific, testable hypotheses about TP_0260 function . Identify and list all independent variables (factors you'll manipulate, such as expression conditions, host cell types, or experimental treatments) and dependent variables (outcomes you'll measure, such as protein expression levels, antibody reactivity, or functional activity) . Control for extraneous variables that might confound your results, such as bacterial contamination or variation in sample preparation .

Implement a true experimental design with proper controls: include negative controls (no TP_0260), positive controls (known T. pallidum antigens like TpN47), and procedural controls . Randomize samples and experimental order where possible to minimize bias. Consider a factorial design if examining multiple variables simultaneously . Include biological and technical replicates to ensure statistical power and reproducibility. Document all methods with sufficient detail to enable replication by other researchers.

How can I optimize expression and purification of recombinant TP_0260 for functional studies?

Optimizing recombinant TP_0260 expression requires a systematic approach. First, evaluate multiple expression systems:

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, simple, low costMay form inclusion bodies, lacks eukaryotic modificationsInitial characterization studies
Yeast (S. cerevisiae, P. pastoris)Eukaryotic folding machinery, secretion capacityModerate yield, glycosylation patterns differ from mammalianProteins requiring disulfide bonds
Mammalian cells (HEK293, CHO)Native-like modifications, foldingLower yield, expensive, time-consumingProteins requiring complex modifications
Cell-free systemsRapid, avoids toxicity issuesLow yield, expensiveToxic proteins, quick screening

Test multiple construct designs with different purification tags (His6, GST, MBP) to improve solubility and facilitate purification. Optimize expression conditions (temperature, induction time, media composition) through systematic testing. For purification, employ a multi-step approach starting with affinity chromatography followed by size exclusion and/or ion exchange chromatography to achieve high purity. Validate the structural integrity of purified protein using circular dichroism or limited proteolysis before proceeding to functional assays.

How should I analyze immunoreactivity data for TP_0260 and interpret contradicting results?

When analyzing TP_0260 immunoreactivity data, implement rigorous statistical methods appropriate for your experimental design. For comparison between groups (e.g., different disease stages or time points), use t-tests for two groups or ANOVA for multiple groups after confirming normality of data distribution . For non-parametric data, use Mann-Whitney or Kruskal-Wallis tests. Calculate confidence intervals and p-values to determine significance.

When faced with contradicting results, consider multiple factors that might explain discrepancies:

  • Host species differences: Rabbit and human immune responses to the same T. pallidum antigen can differ significantly, as observed with TpN15, which shows differential reactivity patterns between experimental animals and clinical samples .

  • Timing of sampling: Immunoreactivity to specific antigens can vary throughout infection. In experimental rabbit models, antibodies to some antigens appear between days 40-50 post-infection, while others emerge earlier .

  • Technical variations: Different assay formats (ELISA, Western blot, protein arrays) may yield varying results for the same antigen. Compare methodologies carefully when integrating data from multiple studies.

  • Sample processing: Serum handling, storage conditions, and freeze-thaw cycles can affect antibody stability and reactivity.

Create a comprehensive data integration table that maps contradicting results to these potential factors, which can help identify patterns and explain discrepancies.

What are appropriate controls and statistical analyses for TP_0260 expression studies?

For TP_0260 expression studies, implement a thorough control strategy:

Experimental Controls:

  • Positive controls: Include well-characterized T. pallidum proteins (e.g., TpN47, TpN17) known to express reliably

  • Negative controls: Empty vector constructs and unrelated proteins expressed under identical conditions

  • Technical controls: Housekeeping genes/proteins for normalization in qPCR or Western blot studies

  • Process controls: Samples collected at each experimental step to identify where problems might occur

Statistical Analysis Framework:

  • Begin with descriptive statistics (mean, median, standard deviation)

  • Assess data normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

  • For normally distributed data, use parametric tests (t-test, ANOVA)

  • For non-normal data, use non-parametric alternatives (Mann-Whitney, Kruskal-Wallis)

  • For time-course experiments, use repeated measures ANOVA or mixed-effects models

  • Implement multiple testing correction (Bonferroni, FDR) when conducting numerous comparisons

  • Consider using more advanced techniques like droplet digital PCR (ddPCR) for absolute quantification

Document all statistical methods thoroughly, including software packages, versions, and specific parameters used.

How can genetic engineering approaches be applied to study TP_0260 function in vivo?

Recent breakthroughs in T. pallidum genetic manipulation provide exciting opportunities for studying TP_0260 function. Researchers have successfully transformed T. pallidum SS14 strain by replacing the tprA pseudogene with a kanamycin resistance cassette using a suicide vector with homology arms . This achievement opens possibilities for genetic studies of T. pallidum genes including TP_0260.

To study TP_0260 function in vivo, consider these approaches:

  • Gene Knockout/Replacement: Design a suicide vector containing a selectable marker (e.g., kanamycin resistance) flanked by homology arms corresponding to TP_0260 upstream and downstream regions . Transform T. pallidum using the established protocol and select transformants using kanamycin. Verify gene deletion using PCR, ddPCR, RT-PCR, whole genome sequencing, and mass spectrometry approaches .

  • Promoter Replacement: To study the effect of TP_0260 overexpression, replace its native promoter with a stronger promoter like that of tp0574, which has been successfully used to drive kanamycin resistance gene expression .

  • Protein Tagging: Insert epitope tags or fluorescent protein coding sequences in-frame with TP_0260 to track protein localization and interactions.

  • Complementation Studies: In knockout strains, reintroduce wild-type or mutant versions of TP_0260 to confirm phenotypes and study structure-function relationships.

Validate successful genetic modifications using a combination of techniques including qualitative PCR, RT-PCR, quantitative droplet digital PCR (ddPCR), whole genome sequencing, and mass spectrometry . Test the phenotypes of modified strains in the rabbit model of syphilis to assess virulence, dissemination, and immune response.

How might TP_0260 contribute to diagnostic applications for syphilis?

To evaluate TP_0260's potential as a diagnostic target, conduct systematic immunoreactivity studies using a pan-proteome array approach similar to that described for other T. pallidum antigens . First, assess TP_0260 reactivity with serum samples from:

  • Different stages of syphilis (primary, secondary, latent, tertiary)

  • Successfully treated patients vs. untreated controls

  • Cases of reinfection vs. primary infection

  • Cross-reactivity with other spirochetal diseases

Compare TP_0260 performance to currently used diagnostic antigens like TpN15, TpN17, and TpN47 in terms of:

Performance MetricDefinitionTarget ValueMeasurement Method
SensitivityProportion of true positives correctly identified>95%Testing against confirmed positive cases
SpecificityProportion of true negatives correctly identified>98%Testing against negative controls and other diseases
Time to seroconversionDays post-infection when antibodies become detectableEarlier than current testsLongitudinal sampling in animal models
Discriminatory abilityCapacity to distinguish active vs. past infectionStatistical significance (p<0.05)Comparative analysis of active vs. treated cases

Current treponemal tests like TPPA and FTA-ABS cannot differentiate between active and past infections, while non-treponemal tests (RPR, VDRL) can indicate active disease but lack specificity . If TP_0260 shows different immunoreactivity patterns during disease progression or following treatment, it might enable development of improved diagnostic approaches that address these limitations.

What are common challenges in working with recombinant T. pallidum proteins and how can they be addressed?

Researchers working with recombinant T. pallidum proteins, including TP_0260, often encounter several challenges:

  • Poor expression or insolubility: T. pallidum proteins frequently form inclusion bodies when expressed in E. coli. Solutions include:

    • Testing multiple expression systems (bacterial, yeast, mammalian)

    • Using solubility-enhancing fusion partners (MBP, SUMO, thioredoxin)

    • Optimizing expression conditions (lower temperature, reduced inducer concentration)

    • Refolding from inclusion bodies using stepwise dialysis or on-column refolding

  • Protein instability: Many T. pallidum proteins degrade rapidly after purification. Address this by:

    • Including protease inhibitors throughout purification

    • Optimizing buffer conditions (pH, salt concentration, additives like glycerol)

    • Testing protein stabilizers (reducing agents, arginine, trehalose)

    • Performing stability screens to identify optimal storage conditions

  • Lack of functionality: Recombinant proteins may fold differently than native proteins. Improve functional relevance by:

    • Verifying correct disulfide bond formation

    • Assessing secondary structure using circular dichroism

    • Conducting limited proteolysis to confirm proper folding

    • Validating activity through functional assays where possible

  • Cross-contamination concerns: When working with multiple T. pallidum antigens, cross-contamination can complicate interpretation. Implement:

    • Strict workflow separation

    • Dedicated equipment for each construct

    • Regular validation of protein identity by mass spectrometry

    • Rigorous negative controls in all experiments

How can I design experiments to determine if TP_0260 contributes to T. pallidum pathogenesis?

Designing experiments to elucidate TP_0260's role in pathogenesis requires a multifaceted approach:

  • Genetic manipulation studies:

    • Create TP_0260 knockout strains using recently developed transformation protocols

    • Compare virulence of wild-type and knockout strains in rabbit model

    • Assess bacterial load, dissemination patterns, and histopathological changes

    • Monitor immune response against knockout vs. wild-type strains

  • Expression profiling:

    • Quantify TP_0260 expression levels at different infection stages using RT-ddPCR

    • Compare expression between attenuated and highly virulent strains

    • Evaluate expression under different environmental conditions (temperature, pH, oxygen)

  • Interaction studies:

    • Identify TP_0260 binding partners in host cells using pull-down assays

    • Test interactions with specific host components (ECM proteins, immune factors)

    • Visualize protein localization during infection using immunofluorescence

    • Evaluate effects on host cell signaling pathways and functional responses

  • Immune response characterization:

    • Assess TP_0260-specific antibody and T cell responses during infection

    • Determine if anti-TP_0260 antibodies have neutralizing activity

    • Evaluate protective capacity of TP_0260 immunization in animal models

For each approach, implement appropriate controls and statistical analyses as described in previous sections. Document all experimental conditions meticulously to ensure reproducibility and facilitate meaningful interpretation of results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.