Recombinant Treponema pallidum Uncharacterized protein TP_0324 (TP_0324)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TP_0324; Uncharacterized protein TP_0324
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-485
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0324
Target Protein Sequence
MAVLPSVRRFECSLFVVLVLCALAVFDPLSGFVQQKLAGVQRVWLGLVEEYSGLRFQYDS LSPSVLRAVTLRNVRVREAVRGEQVAVFSKIVVAYNIFSLFGSNPVRGIRALHVHDGAVD VDLYRHRHVKEKLQKLFSKDGEMASFFADLREIDVRVHNTAVTVRSDSRRAHLSVPQGRF SFAETGASFALSCEAEYVDTRSSSWGPLYTHLDASGVFETSFTSGSATLELAPPSGSFFS VPTLTLVAIYADDLFKFHTARGIYPMEVSGQWNTATGACEASVRCENFRPLKWARLRDTH VPAQGMQELSVSGNVQVGYTPIEQWRWSADVHAHTPYVVLAPGYQLEDVVATLQAHGDPA RIQVEKICARGSNLDVDGAFELTLDRWIPSGVLTVHRLPLLSGAYLSAQVRFRPQGVGFV CTVPRIQVGEAFLEDVALSVRVDPAKTDFRLVAADSTGRYECDGSYLAANAGSLAFLRHT WRLNR
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0324

STRING: 243276.TP0324

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What structural features can be predicted for TP_0324?

Bioinformatic analysis suggests TP_0324 contains a signal sequence at the N-terminus, indicating it may be a secreted or membrane-associated protein. The presence of a signal peptide is consistent with the systematic cloning approach that identified 248 T. pallidum proteins with predicted signal sequences that are potentially secreted from the cell . The N-terminal sequence "MAVLPSVRRFECSLFVVLVLCALAVFDP" shows characteristics typical of bacterial signal peptides, suggesting TP_0324 may localize to the periplasmic space or membrane, which is consistent with findings that many T. pallidum antigenic proteins localize to bacterial membranes or periplasmic space .

What expression systems are suitable for recombinant TP_0324 production?

Multiple expression systems have been validated for TP_0324 production:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, economical, rapidMay require optimization for proper folding
YeastPost-translational modifications, secretionLonger production time, higher cost
BaculovirusEukaryotic modifications, high yieldTechnical complexity, resource-intensive
Mammalian CellNative-like folding and modificationsHighest cost, longest production time

E. coli has been successfully used as a host for recombinant TP_0324 production, as documented in several sources . When expressing in E. coli, researchers typically fuse the protein to N-terminal His-tag to facilitate purification .

What purification protocol yields the highest purity for recombinant TP_0324?

A multi-step purification protocol is recommended:

  • Initial capture using immobilized metal affinity chromatography (IMAC) if His-tagged

  • Intermediate purification via ion exchange chromatography

  • Polishing step with size exclusion chromatography

This approach has been effective for purifying other T. pallidum recombinant proteins with similar characteristics. The final product should achieve >90% purity as determined by SDS-PAGE .

How should recombinant TP_0324 be stored to maintain stability?

According to product information, purified recombinant TP_0324 should be stored as follows:

  • Long-term storage: -20°C/-80°C in aliquots to prevent freeze-thaw cycles

  • Working solution: 4°C for up to one week

  • Storage buffer: Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

For reconstitution, it is recommended to use deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol as a cryoprotectant (final concentration) .

What approaches can be used to elucidate the function of TP_0324?

Since TP_0324 remains uncharacterized, several complementary approaches can be employed:

  • Structural analysis: X-ray crystallography or cryo-EM to determine 3D structure

  • Comparative genomics: Identify orthologs in related species with known functions

  • Protein-protein interaction studies: Yeast two-hybrid, pull-down assays, or co-immunoprecipitation

  • Transcriptional analysis: Examine expression patterns during infection using RNA-seq data

  • Immunological studies: Assess immunogenicity and potential as a diagnostic marker

A comprehensive RNA-seq study comparing T. pallidum gene expression during in vitro culture versus rabbit infection could provide insights into TP_0324's potential role in pathogenesis .

How does TP_0324 expression change during infection?

While TP_0324-specific expression data wasn't directly reported in the search results, a transcriptional profiling study of T. pallidum during in vitro culture versus rabbit infection revealed that 94 genes (9% of the genome) showed significantly different expression levels between these conditions . This differential expression analysis methodology would be applicable to studying TP_0324 regulation during infection stages.

Is TP_0324 antigenic during T. pallidum infection?

While TP_0324 was not specifically identified among the 12 antigenic proteins in the systematic screening of 85 potentially secreted T. pallidum proteins , its predicted membrane or periplasmic localization suggests it could be antigenic. A systematic proteome analysis detected 557 unique T. pallidum proteins from rabbit-isolated bacteria, representing 54% of the predicted proteome . This suggests comprehensive antigenicity studies of T. pallidum proteins, including TP_0324, are ongoing.

How can the antigenicity of TP_0324 be evaluated experimentally?

To evaluate TP_0324 antigenicity:

  • Express and purify recombinant TP_0324

  • Test reactivity with sera from:

    • Rabbits infected with T. pallidum

    • Human patients with different stages of syphilis

    • Control subjects with no history of syphilis

Established protocols for evaluating T. pallidum antigens include:

  • GST-fusion protein expression systems

  • Chemiluminescence-based immunoassays

  • Statistical analysis using t-tests for independent samples with P scores of P < 0.001

What is the potential of TP_0324 as a diagnostic marker for syphilis?

The performance of recombinant T. pallidum proteins in syphilis diagnostics has been evaluated using liquid microarray technology, which could be applied to assess TP_0324's diagnostic potential . Current treponemal tests for syphilis diagnosis show variable sensitivity and specificity:

AssaySensitivitySpecificity
TP-PA95.4%100%
LIAISON CIA96.9%94.5%
Bioplex MBIA96.9%96.7%
INNO-LIA96.9%98.5%

Including TP_0324 in a diagnostic panel could potentially enhance test performance, especially if it demonstrates strong immunoreactivity in early infection stages .

How can TP_0324 be studied in the context of T-cell responses during syphilis infection?

Recent research has demonstrated that T. pallidum infection elicits antigen-specific CD4+ T cell responses in both blood and skin, with T. pallidum-specific T cells persisting in both compartments after treatment . To study TP_0324-specific T-cell responses:

  • Ex vivo detection: Use IFNγ ELISPOT to screen PBMC responses to recombinant TP_0324

  • T-cell line generation: Develop TP_0324-reactive T cell lines from blood and skin biopsies

  • Epitope mapping: Identify peptide epitopes using overlapping peptide libraries

  • HLA restriction determination: Define HLA class II restrictions for identified epitopes

  • Memory response assessment: Evaluate persistence of TP_0324-specific T cells after treatment

This approach would follow methodologies used to identify 14 T. pallidum proteins recognized by CD4+ T cells, 13 of which localize to bacterial membranes or periplasmic space .

What proteomics approaches are optimal for studying TP_0324 in the context of the T. pallidum proteome?

Complementary mass spectrometry techniques have proven effective for T. pallidum proteome characterization:

  • Multidimensional peptide separation

  • MALDI-TOF/TOF tandem mass spectrometry

  • ESI-LTQ-Orbitrap tandem mass spectrometry

These techniques enabled detection of 6033 peptides corresponding to 557 unique T. pallidum proteins (54% of predicted proteome) . For TP_0324 specifically, these approaches could determine:

  • Protein abundance using label-free spectral counting

  • Post-translational modifications

  • Localization within bacterial fractions

  • Potential binding partners

What role might TP_0324 play in vaccine development efforts against syphilis?

Given that T. pallidum membrane proteins are high-priority vaccine candidates , TP_0324's predicted membrane localization makes it potentially relevant for vaccine development. Evaluation should include:

  • Assessment of conservation across T. pallidum strains

  • Determination of surface exposure

  • Evaluation of immunogenicity in animal models

  • Testing protective efficacy in the rabbit model of experimental syphilis

The experience with Tp0971, which demonstrated delay of skin damage and promoted healing at T. pallidum infection sites in rabbits , provides a methodological framework for evaluating TP_0324's vaccine potential.

What are the most promising research directions for TP_0324?

Based on current knowledge, priority research areas for TP_0324 include:

  • Definitive characterization of cellular localization

  • Functional analysis through protein interaction studies

  • Evaluation of immunogenicity during different stages of syphilis

  • Assessment of diagnostic potential in combination with established T. pallidum antigens

  • Investigation of potential role in pathogenesis through comparative transcriptomics

These investigations would contribute to the broader understanding of T. pallidum biology and potentially lead to improved diagnostic or therapeutic approaches for syphilis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.