Recombinant Treponema pallidum Uncharacterized protein TP_0335 (TP_0335)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TP_0335; Uncharacterized protein TP_0335
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0335
Target Protein Sequence
MAITTAGDICALYPLCPILLHCSTLMHLSPLRNTPHVLHAAAAVTEYAFVLSTLVFPSFC FSLPSPFPFPEGEGGAFYVRLFLNALSEEVLFRAYIPERLCHHATSCTARACGEVLSVLL FALAHRPAGSATLFAGAAGAALRVLFVREKKRSGSRARASALCTAVHALWNAYAIAAAAR
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0335

STRING: 243276.TP0335

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Treponema pallidum TP_0335 and why is it significant for research?

TP_0335 is an uncharacterized protein from Treponema pallidum, the causative agent of syphilis. It consists of 180 amino acids and has been assigned the UniProt accession number O83355 . As an uncharacterized protein in a significant human pathogen, TP_0335 represents an important research target for several reasons:

First, understanding its function could provide crucial insights into T. pallidum biology and pathogenesis mechanisms. Second, all proteins from this organism are potential targets for diagnostic tool development, particularly since current serological tests for syphilis have limitations in distinguishing between active and past infections . Third, T. pallidum proteins are being investigated as potential vaccine candidates through reverse vaccinology and immunoinformatics approaches . Finally, studying uncharacterized proteins contributes to our fundamental understanding of protein structure-function relationships in spirochetes.

The protein has been successfully expressed as a recombinant construct with an N-terminal His-tag in E. coli systems, facilitating its purification and characterization .

What expression systems are optimal for recombinant TP_0335 production?

Several expression systems can be utilized for the production of recombinant TP_0335, each with distinct advantages and limitations for research applications:

Expression SystemAdvantagesLimitationsNotes for TP_0335
E. coliFast growth, high yields, economical, well-established protocolsLimited post-translational modificationsSuccessfully used with N-terminal His-tag
Yeast (S. cerevisiae, P. pastoris)Eukaryotic PTMs, secretion possibleLonger expression time than E. coliNot reported for TP_0335 but potential alternative
Cell-free systemsRapid, avoids toxicity issuesExpensive, limited scalePotential for difficult-to-express variants

Based on the available literature, E. coli remains the system of choice for TP_0335 expression, particularly for structural studies requiring substantial amounts of protein . The successful expression with an N-terminal His-tag facilitates purification using standard immobilized metal affinity chromatography (IMAC) protocols. When designing expression constructs, researchers should consider whether the His-tag might interfere with functional studies and potentially include a protease cleavage site for tag removal.

For functional studies where post-translational modifications might be important, yeast expression systems could be considered as alternative approaches, though this would require optimization.

What purification strategies are most effective for recombinant TP_0335?

Purification of recombinant His-tagged TP_0335 typically follows a multi-step chromatography workflow designed to achieve high purity while maintaining protein stability and function:

  • Cell Lysis and Extract Preparation:

    • Sonication or high-pressure homogenization in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

    • Centrifugation at 20,000 × g for 30 minutes to remove cell debris

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Binding to Ni-NTA or similar resin in the presence of 10-20 mM imidazole to reduce non-specific binding

    • Washing with increasing imidazole concentrations (typically 20-50 mM)

    • Elution with 250-500 mM imidazole buffer

  • Size Exclusion Chromatography (SEC):

    • Further purification on Superdex 75 or Superdex 200 columns based on the oligomeric state

    • Running buffer typically containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl

  • Quality Control Assessment:

    • SDS-PAGE to confirm purity

    • Western blotting with anti-His antibodies to confirm identity

    • Mass spectrometry for accurate molecular weight determination

    • Dynamic light scattering to assess homogeneity

For advanced structural or functional studies, additional considerations include buffer optimization through thermal shift assays, tag removal using specific proteases if required, and concentration optimization to prevent aggregation.

What experimental approaches can determine the function of uncharacterized TP_0335?

Elucidating the function of TP_0335 requires a systematic multi-disciplinary approach:

  • Computational Prediction Strategies:

    • Sequence-based homology searches using sensitive methods (PSI-BLAST, HHpred)

    • Structural prediction using AlphaFold2 followed by structural homology searches

    • Genomic context analysis examining neighboring genes in the T. pallidum genome

  • Localization Studies:

    • Computational prediction of subcellular localization

    • Generation of specific antibodies against TP_0335 for immunolocalization

    • Cellular fractionation followed by Western blotting

  • Interaction Partner Identification:

    • Pull-down assays using tagged recombinant TP_0335

    • Crosslinking mass spectrometry to identify proteins in close proximity

    • Yeast two-hybrid screening against T. pallidum or human protein libraries

  • Biochemical Function Assessment:

    • Enzymatic activity screens based on predicted structural features

    • Binding assays with host components (ECM proteins, immune factors)

    • Thermal shift assays with potential substrates or cofactors

A systematic experimental workflow would begin with bioinformatic predictions to generate testable hypotheses, followed by expression and purification of TP_0335, validation of proper folding, and targeted biochemical assays based on the predictions. Any positive signals would be validated using orthogonal approaches to confirm specificity.

The comprehensive characterization strategy should account for the technical challenges of working with T. pallidum proteins, including potential toxicity in expression systems and the lack of continuous culture methods for the native organism .

How can protein-protein interactions of TP_0335 be identified and characterized?

Understanding the interactome of TP_0335 requires applying multiple complementary techniques that provide different levels of information about interaction partners and binding characteristics:

  • In Vitro Interaction Analysis:

TechniquePrincipleAdvantagesLimitationsApplication to TP_0335
Pull-down assaysImmobilized tagged TP_0335 captures binding partnersDirect detectionMay miss weak interactionsCan use His-tagged TP_0335
Surface Plasmon ResonanceReal-time binding kineticsProvides kon/koff and KD valuesRequires purified partnersQuantitative analysis
Isothermal Titration CalorimetryMeasures heat changes during bindingLabel-free, thermodynamic dataHigh protein consumptionValidation of key interactions
Crosslinking Mass SpectrometryIdentifies proteins in proximityCaptures transient interactionsComplex data analysisUnbiased partner identification
  • Library-Based Screening Methods:

    • Yeast Two-Hybrid (Y2H) with TP_0335 as bait against T. pallidum or human libraries

    • Bacterial Two-Hybrid systems, particularly relevant for maintaining the native environment

    • Phage Display to identify specific binding peptide motifs

  • In Silico Approaches:

    • Molecular Docking using the predicted structure of TP_0335

    • Coevolution Analysis to identify potentially interacting proteins

    • Integration with T. pallidum transcriptomics data to identify co-expressed genes

For TP_0335, a strategic approach would begin with His-tag based pull-down experiments to identify preliminary interaction partners, followed by validation using biophysical methods like SPR or ITC. Identified interactions would be further characterized for their functional significance through targeted mutagenesis and functional assays.

The interpretation of interaction data should consider the potential role of TP_0335 in host-pathogen interactions, as many surface or secreted proteins from T. pallidum are involved in immune evasion or adhesion to host tissues .

What challenges are specific to characterizing uncharacterized proteins like TP_0335 in Treponema pallidum?

Characterizing uncharacterized proteins from T. pallidum presents unique challenges that require specialized approaches:

  • Cultivation Limitations:

    • T. pallidum cannot be continuously cultured in vitro, severely limiting access to native protein

    • Dependency on recombinant expression in heterologous hosts like E. coli

    • Potential differences in post-translational modifications between native and recombinant protein

  • Genetic Manipulation Barriers:

    • Limited genetic tools for T. pallidum compared to model organisms

    • Difficulties in creating knockout mutants for functional validation

    • Alternative approaches like heterologous expression or antibody inhibition are necessary

  • Structural and Expression Challenges:

    • Potential toxicity of spirochetal proteins in expression hosts

    • Membrane or membrane-associated proteins presenting difficulties in expression and purification

    • Proper folding validation required for recombinant proteins

  • Functional Context:

    • Many T. pallidum proteins function in host-pathogen interactions that are difficult to recapitulate in vitro

    • Limited animal models for functional validation (primarily rabbit models)

    • Complex disease progression with different protein expression patterns across infection stages

  • Bioinformatic Limitations:

    • Many T. pallidum proteins lack clear homologs with known functions

    • Unique adaptations in this obligate human pathogen limiting comparative approaches

Strategies to overcome these challenges include:

  • Multi-pronged approaches combining structural, biochemical, and computational methods

  • Development of in vitro models that mimic aspects of the host environment

  • Application of advanced structural techniques like cryo-EM

  • Creation of artificial membrane systems to study potential membrane-associated functions

  • Integration of data from related spirochetes with more developed genetic systems

What methods are most appropriate for structural characterization of TP_0335?

Structural characterization of TP_0335 can be approached through multiple complementary techniques:

  • X-ray Crystallography:

    • Requires production of diffraction-quality crystals

    • Provides high-resolution atomic structures

    • Optimization of crystallization conditions is critical

    • May require engineering (e.g., surface entropy reduction) to enhance crystallizability

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Suitable for TP_0335 due to its relatively small size (180 amino acids)

    • Provides information on protein dynamics in solution

    • Requires isotopic labeling (¹⁵N, ¹³C, ²H) through expression in minimal media

    • Optimal for identifying flexible regions and studying ligand interactions

  • Cryo-Electron Microscopy (cryo-EM):

    • Typically used for larger proteins or complexes

    • May be valuable if TP_0335 forms larger assemblies

    • Sample preparation is critical for high-resolution data collection

  • Small-Angle X-ray Scattering (SAXS):

    • Provides low-resolution envelope of protein shape in solution

    • Useful for validating higher-resolution structures in physiological conditions

    • Can characterize conformational changes upon ligand binding

  • Computational Structure Prediction:

    • AlphaFold2 and RoseTTAFold provide increasingly accurate predictions

    • Serves as a starting point for experimental validation

    • Particularly valuable for proteins resistant to experimental structure determination

A practical workflow for TP_0335 structural characterization would include:

  • Computational structure prediction to guide experimental design

  • Expression optimization for high-yield, high-purity protein production

  • Initial characterization by circular dichroism to confirm secondary structure

  • NMR spectroscopy for solution structure determination

  • Crystallization trials for high-resolution structure

  • Integration of experimental data with computational models

The choice between methods depends on research goals, available resources, and the specific properties of TP_0335. A hybrid approach combining multiple methods often provides the most comprehensive structural understanding.

How can isotopic labeling be applied to study TP_0335 structure by NMR?

Isotopic labeling is essential for NMR studies of proteins like TP_0335, enabling diverse experimental approaches for structural and dynamic characterization:

  • Uniform Labeling Strategies:

    • ¹⁵N Labeling: Foundational approach enabling ¹H-¹⁵N HSQC experiments to assess protein folding

    • ¹³C,¹⁵N Double Labeling: Enables triple-resonance experiments for backbone and side-chain assignments

    • ²H,¹³C,¹⁵N Triple Labeling: Improves spectral quality for proteins >20 kDa by reducing relaxation

  • Expression Protocol for Isotopic Labeling:

Labeling TypeMedia CompositionExpression Considerations
¹⁵NM9 minimal media with ¹⁵NH₄ClLower yields than rich media; typically 3-5 mg/L
¹³C,¹⁵NM9 with ¹⁵NH₄Cl and [¹³C]-glucoseMore expensive; yields typically 2-4 mg/L
²H,¹³C,¹⁵NM9 prepared in D₂O with labeled precursorsRequires adaptation of E. coli to D₂O; yields 1-2 mg/L
  • Selective Labeling Approaches:

    • Amino acid-specific labeling: Incorporation of specific ¹⁵N or ¹³C labeled amino acids

    • Methyl labeling: Selective labeling of Ile, Leu, Val methyl groups for studying larger systems

    • Segmental labeling: For studying specific regions within TP_0335 if it has distinct domains

  • Experimental Workflow for TP_0335:

    • Initial ¹⁵N-HSQC to assess protein folding and stability

    • Optimization of buffer conditions (pH, salt, additives) to maximize spectral quality

    • Triple-resonance experiments for backbone assignment (HNCA, HNCACB, CBCA(CO)NH)

    • NOESY experiments to derive distance restraints

    • Residual Dipolar Coupling measurements for orientational restraints

    • Structure calculation and refinement using ARIA, CYANA, or similar software

  • Complementary Applications:

    • Relaxation measurements (T₁, T₂, NOE) to characterize protein dynamics

    • Hydrogen-deuterium exchange to identify protected regions

    • Chemical shift perturbation experiments to map binding interfaces

By leveraging these isotopic labeling strategies with the 180-amino acid TP_0335 protein , researchers can obtain detailed structural information, characterize dynamics, and identify potential functional sites, providing crucial insights into this uncharacterized protein from T. pallidum.

How can structural analyses of TP_0335 contribute to understanding T. pallidum pathogenesis?

Structural analyses of TP_0335 can provide significant insights into T. pallidum pathogenesis through multiple avenues:

  • Functional Annotation Through Structure:

    • Identification of structural motifs associated with specific functions

    • Recognition of catalytic sites suggesting enzymatic activity

    • Structural similarity to proteins of known function, even in the absence of sequence similarity

    • Prediction of protein-protein interaction interfaces

  • Pathogenesis Mechanism Insights:

    • Determination if TP_0335 has structural features associated with virulence factors

    • Identification of potential host receptor binding domains

    • Recognition of immune evasion strategies through structural elements

    • Correlation of structure with localization (membrane-associated, secreted, etc.)

  • Vaccine Development Applications:

    • Identification of surface-exposed regions as potential B-cell epitopes

    • Structural mapping of predicted T-cell epitopes

    • Stability analysis for potential inclusion in multi-epitope vaccine constructs

    • Identification of conserved structural elements across T. pallidum strains

  • Diagnostic Development:

    • Determination of unique structural features for specific antibody development

    • Identification of regions that could be incorporated into serological tests

    • Assessment of structural features that differentiate TP_0335 from homologs in non-pathogenic treponemes

  • Therapeutic Target Assessment:

    • Evaluation of potential binding pockets for small molecule inhibitors

    • Structure-based virtual screening to identify potential inhibitors

    • Druggability assessment based on pocket characteristics

The value of structural data is maximized when integrated with other data types, including:

  • Comparative genomics across T. pallidum strains

  • Transcriptomic data showing expression patterns during infection

  • Immunological data on human immune responses to T. pallidum

  • Functional data from biochemical and cell biology experiments

This integrated approach ensures that structural insights translate to meaningful advances in understanding syphilis pathogenesis and developing interventions against this important pathogen.

How can the immunogenicity of TP_0335 be assessed for vaccine development?

Assessing the immunogenicity of TP_0335 for vaccine development requires a comprehensive approach combining computational predictions with experimental validation:

  • Computational Immunogenicity Assessment:

    • MHC Class I binding prediction for CD8+ T cell epitopes using NetMHCpan or IEDB tools

    • MHC Class II binding prediction for CD4+ T cell epitopes using NetMHCIIpan

    • B cell epitope prediction using BepiPred, ABCpred, and structural information

    • Antigenicity prediction using VaxiJen to identify protective antigen potential

    • Population coverage analysis across diverse human HLA types using IEDB tools

  • Experimental Immunogenicity Evaluation:

    • Serological Studies:

      • ELISA with purified recombinant TP_0335 against sera from syphilis patients at different disease stages

      • Western blot analysis to confirm specificity of antibody responses

      • Comparison with serological responses to characterized T. pallidum antigens

    • T Cell Response Assessment:

      • ELISPOT assays measuring IFN-γ secretion from patient PBMCs stimulated with TP_0335

      • Flow cytometry analysis of intracellular cytokine production

      • CD4+ and CD8+ T cell proliferation assays

    • Epitope Mapping:

      • Peptide microarrays with overlapping peptides covering TP_0335 sequence

      • Confirmation of predicted epitopes through targeted peptide synthesis and testing

      • Structural mapping of confirmed epitopes

  • Integration with Multi-Epitope Vaccine Development:

    • Selection of validated epitopes for inclusion in chimeric peptide constructs

    • Addition of appropriate linkers between epitopes to maintain individual epitope integrity

    • Incorporation of adjuvanting sequences (e.g., TLR agonists) to enhance immunogenicity

    • In silico modeling of chimeric constructs to ensure epitope exposure

  • Animal Model Testing:

    • Immunization of rabbits with recombinant TP_0335 or epitope constructs

    • Evaluation of antibody titers, isotype distribution, and T cell responses

    • Challenge studies to assess protection against T. pallidum infection

    • Analysis of immunological memory and duration of protection

This systematic approach aligns with current reverse vaccinology and immunoinformatics strategies being applied to T. pallidum proteins as described in the systematic review literature , providing a pathway to evaluate TP_0335's potential as a component of a syphilis vaccine.

What role might TP_0335 play in diagnostic development for syphilis?

TP_0335 could potentially contribute to improved syphilis diagnostics through several avenues, addressing current limitations in serological testing:

  • Serological Test Development:

    • Current syphilis testing relies on treponemal and non-treponemal antibody detection, with limitations in distinguishing active from past infection

    • TP_0335 could serve as a novel antigen in ELISA or lateral flow immunoassays if:

      • It is immunogenic during natural infection

      • Antibody responses show correlation with disease stage or activity

      • It demonstrates high sensitivity and specificity compared to current antigens

  • Evaluation Strategy for Diagnostic Potential:

    • Screening of sera from confirmed cases at different stages (primary, secondary, latent, tertiary)

    • Analysis of antibody kinetics against TP_0335 during disease progression and treatment

    • Cross-reactivity assessment with other spirochetal infections

    • Comparison with established T. pallidum antigens used in diagnostics

  • Multiplex Diagnostic Applications:

    • Integration into protein microarrays alongside other T. pallidum antigens

    • Development of bead-based multiplex assays (Luminex technology)

    • Machine learning pattern recognition from multiple antigen responses for improved staging

  • Molecular Diagnostic Possibilities:

    • PCR primer design targeting the TP_0335 gene for direct detection

    • Development of LAMP (Loop-mediated isothermal amplification) assays for point-of-care testing

    • Digital PCR applications for quantitative assessment

  • Stage-Specific Diagnostic Development:

    • If TP_0335 expression or immunogenicity varies during different infection stages, it could help differentiate between active and past infection, addressing a key limitation of current tests

    • Potential for developing tests that monitor treatment efficacy based on antibody titer changes

The development pathway would involve:

  • Expression and purification of recombinant TP_0335

  • Initial immunoreactivity assessment with diverse patient sera

  • Sensitivity and specificity determination through clinical studies

  • Optimization of assay conditions and formats

  • Comparison with current diagnostic standards

  • Regulatory validation studies

The ultimate value of TP_0335 in diagnostics would depend on whether it offers advantages over current antigens in terms of sensitivity, specificity, or the ability to distinguish between active and past infection .

How does TP_0335 compare to similar proteins in other spirochetes?

Comparative analysis of TP_0335 with proteins in other spirochetes provides evolutionary and functional insights:

  • Homology Analysis:
    The first step in comparative analysis is identifying potential homologs using sensitive sequence comparison tools like PSI-BLAST, HHpred, or HMMER. An analysis would examine:

    • Conservation within Treponema species (T. pallidum subspecies, T. denticola, T. phagedenis)

    • Presence in other pathogenic spirochetes (Borrelia, Leptospira)

    • Identification of conserved domains or motifs

    • Sequence divergence patterns suggesting adaptive evolution

  • Structural Comparison:

    • Prediction of structures using AlphaFold2 or similar tools for TP_0335 and identified homologs

    • Comparison of structural features even when sequence conservation is limited

    • Identification of conserved binding pockets or catalytic sites

    • Analysis of surface properties (electrostatic potential, hydrophobicity)

  • Genomic Context Analysis:

    • Examination of genes surrounding TP_0335 in T. pallidum and its homologs

    • Identification of conserved operonic structures suggesting functional relationships

    • Analysis of promoter regions for shared regulatory elements

  • Evolutionary Analysis:

    • Construction of phylogenetic trees to determine evolutionary relationships

    • Identification of positive selection signatures suggesting host-adaptation

    • Assessment of lateral gene transfer events

    • Analysis of coevolution with other proteins, suggesting functional interactions

  • Functional Implications:

    • If homologs in other spirochetes have known functions, these provide testable hypotheses

    • Identification of spirochete-specific features that might represent adaptation to their unique biology

    • Recognition of pathogen-specific innovations versus conserved spirochetal functions

This comparative analysis provides an evolutionary framework for understanding TP_0335 and can guide functional experiments by suggesting conserved roles across spirochetes. The information gained can be particularly valuable given the challenges in direct functional characterization in T. pallidum itself .

What bioinformatic approaches are most effective for predicting TP_0335 function?

Predicting the function of uncharacterized proteins like TP_0335 requires an integrative bioinformatics approach:

  • Sequence-Based Function Prediction:

    • BLASTp against UniProt/SwissProt for close homologs

    • PSI-BLAST for distant homologs through iterative profile building

    • HHpred/HHsearch for profile-profile comparisons, detecting remote homology

    • HMMER searches against domain databases (Pfam, SMART, CDD)

    • Analysis of conserved motifs and patterns using PROSITE and similar tools

  • Structure-Based Prediction:

    • AlphaFold2 for high-accuracy 3D structure prediction

    • Structure comparison using Dali, VAST, or TM-align to identify structural homologs

    • Binding site prediction using 3DLigandSite and similar tools

    • Pocket detection and analysis using CASTp or POCASA

    • Electrostatic surface analysis to identify potential interaction regions

  • Integrative Approaches:

    • Genomic context analysis examining operonic structures in T. pallidum

    • Protein-protein interaction network prediction using STRING

    • Metabolic pathway gap analysis to identify missing functions

    • Coexpression analysis with T. pallidum transcriptomic data

    • Machine learning methods like DeepFRI for integrated prediction

  • Pathogen-Specific Analysis:

    • Virulence factor prediction using specialized tools

    • Host-pathogen interaction database comparisons

    • Secretion signal prediction to assess potential for extracellular localization

    • Immunogenicity prediction to evaluate potential roles in host interaction

  • Practical Implementation Strategy:

    • Initial broad searches to identify potential functions

    • Filtering predictions based on consistency across methods

    • Integration of multiple lines of evidence to generate testable hypotheses

    • Experimental validation of top predictions through targeted biochemical assays

This multi-layered approach maximizes the chance of functional insight for proteins like TP_0335 that lack clear homologs of known function. The predictions generated should be viewed as hypotheses to guide experimental work rather than definitive functional assignments .

What are the key research priorities for advancing our understanding of TP_0335?

Based on the current state of knowledge about TP_0335 and T. pallidum research more broadly, several key research priorities emerge:

  • Fundamental Characterization:

    • Comprehensive structural determination using X-ray crystallography, NMR, or cryo-EM

    • Detailed biochemical characterization to identify potential enzymatic activities

    • Localization studies to determine cellular distribution in T. pallidum

    • Expression analysis during different stages of infection and under varying conditions

  • Functional Elucidation:

    • Systematic screening for potential binding partners from both pathogen and host

    • Development of functional assays based on bioinformatic predictions

    • Investigation of potential roles in known virulence mechanisms

    • Analysis of contributions to T. pallidum survival in host environments

  • Immunological Assessment:

    • Characterization of natural immune responses to TP_0335 in syphilis patients

    • Evaluation as a component for multi-epitope vaccine development

    • Assessment of antibody responses as potential diagnostic markers

    • Investigation of potential immune evasion functions

  • Technological Development:

    • Optimization of expression and purification protocols for higher yields

    • Development of specific antibodies or nanobodies against TP_0335

    • Application of advanced structural biology techniques for dynamic studies

    • Integration with emerging systems biology approaches

  • Translational Research:

    • Assessment as a diagnostic biomarker for active syphilis infection

    • Evaluation as a potential drug target through structure-based approaches

    • Investigation as a component in multivalent vaccine formulations

    • Development of inhibitors if enzymatic activity is identified

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.