Recombinant Treponema pallidum Uncharacterized protein TP_0381 (TP_0381)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Treponema pallidum Uncharacterized Protein TP_0381

Recombinant Treponema pallidum Uncharacterized Protein TP_0381 is a protein derived from the bacterium Treponema pallidum, which is known for causing syphilis, bejel, and yaws. This protein is expressed in Escherichia coli (E. coli) and is typically fused with a His-tag for easier purification and detection. The full-length protein consists of 238 amino acids and is often used in research settings to study the biology of Treponema pallidum and potential applications in diagnostics or vaccine development.

Characteristics of Recombinant Treponema pallidum Uncharacterized Protein TP_0381

  • Source and Expression Host: The protein is expressed in E. coli, a common host for recombinant protein production due to its well-understood genetics and ease of manipulation .

  • Protein Length and Tag: The full-length protein includes 238 amino acids and is His-tagged, facilitating purification using affinity chromatography .

  • Purity and Storage: The protein is typically purified to a purity of greater than 90% as determined by SDS-PAGE. It is stored as a lyophilized powder and should be kept at -20°C or -80°C to maintain stability .

Biochemical Functions and Pathways

While the specific biochemical functions of TP_0381 are not well-characterized, proteins from Treponema pallidum often play roles in membrane transport, lipoprotein enrichment, and exploiting host-derived metabolites . The involvement of TP_0381 in specific pathways or interactions with other proteins is an area of ongoing research.

Research Applications

Recombinant proteins like TP_0381 are crucial for studying Treponema pallidum due to the bacterium's inability to be cultured in vitro. These proteins can be used in serodiagnostic tests, vaccine development, and understanding the pathogenesis of syphilis and related diseases .

Table 1: Characteristics of Recombinant Treponema pallidum Uncharacterized Protein TP_0381

CharacteristicDescription
SourceE. coli
SpeciesTreponema pallidum
TagHis-tag
Protein LengthFull Length (1-238)
Purity>90%
Storage-20°C or -80°C

Table 2: Amino Acid Sequence of TP_0381

The amino acid sequence of TP_0381 starts with: MLGAELADTGLFVRFGALHFAIASVAVLLSALFVLLPFALPRLLAHKNLARAGVAILFLR LGLMLCGTLLDGRSWRNELPFHLCPAALISGSLYFITRRPIFFNLLYFWHFGSFVAVLYP DLTRAHTILYAYLFMLTHCLEPAMVVFSLLHLRERISKRGLQCAVLGFLLLAANALFWNR RLGANYLFISKYPLEILRVIRPFFVYQLLFVSALCLLMLVLYLPFRPSQHGRNQLFVI .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format we have in stock. However, if you require a specific format, please specify your needs when placing the order, and we will prepare it according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to settle the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your specified tag.
Synonyms
TP_0381; Uncharacterized protein TP_0381
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-238
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0381
Target Protein Sequence
MLGAELADTGLFVRFGALHFAIASVAVLLSALFVLLPFALPRLLAHKNLARAGVAILFLR LGLMLCGTLLDGRSWRNELPFHLCPAALISGSLYFITRRPIFFNLLYFWHFGSFVAVLYP DLTRAHTILYAYLFMLTHCLEPAMVVFSLLHLRERISKRGLQCAVLGFLLLAANALFWNR RLGANYLFISKYPLEILRVIRPFFVYQLLFVSALCLLMLVLYLPFRPSQHGRNQLFVI
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0381

STRING: 243276.TP0381

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How can I design optimal experiments to characterize the function of TP_0381 using statistical approaches?

Characterizing uncharacterized proteins like TP_0381 requires sophisticated experimental design. A systematic Design of Experiments (DoE) approach should be implemented:

  • Factor Identification: Identify key variables likely affecting TP_0381 function:

    • pH (5.0-9.0)

    • Temperature (25-42°C)

    • Ionic strength (50-500 mM)

    • Potential binding partners

  • Implementation Strategy:

    • Begin with a screening design to identify significant factors

    • Follow with response surface methodology to optimize conditions

    • Validate with confirmation runs at optimal conditions

  • Analysis Methods:

    • Apply submodular optimization and mutual information approaches as described in patent US11017316B2

    • Use multivariate analysis to identify interaction effects between factors

For example, when investigating potential binding partners of TP_0381, a 2³ factorial design would test three factors at two levels each, requiring only 8 experimental runs instead of multiple one-at-a-time experiments, significantly reducing experimental workload while maintaining statistical power .

  • How can flow cytometry and fluorescent labeling be applied to study TP_0381's role in host-pathogen interactions?

Recent advances in T. pallidum research using GFP-expressing strains provide a framework for studying TP_0381's role in host-pathogen interactions . A comprehensive approach should include:

  • GFP Fusion Protein Generation:

    • Create a TP_0381-GFP fusion construct similar to the methodology described by researchers who developed GFP-expressing T. pallidum

    • Express in both heterologous systems and in native T. pallidum using recently developed genetic tools

  • Interaction Studies:

    • Co-culture labeled bacteria with host cells (epithelial cells, macrophages)

    • Track real-time interaction dynamics using live-cell imaging

    • Quantify interaction kinetics using flow cytometry

  • Antibody-Mediated Effects Assessment:

    • Develop a flow cytometric assay similar to that used for GFP+ T. pallidum

    • Measure dose-dependent growth inhibition and outer membrane disruption

    • Compare strain-specific antibody responses

  • Data Analysis Protocol:

    • Implement appropriate compensation and gating strategies

    • Use fluorescence intensity as a quantitative measure of binding

    • Apply statistical methods to determine significance of interactions

This approach leverages recent technological advances that enabled visualization of "TPA interactions with host cells during co-cultivation in vitro, within infected rabbit testes, and following opsonophagocytosis by murine bone marrow-derived macrophages" , adapting them specifically for TP_0381 studies.

  • What is the evidence for transcriptional regulation of TP_0381 and how can this be experimentally validated?

Evidence from related Treponema pallidum genes suggests TP_0381 may be subject to transcriptional regulation through mechanisms similar to those observed in tpr genes . A comprehensive investigation should include:

  • Promoter Analysis:

    • Examine the TP_0381 upstream region for homopolymeric repeats (particularly poly-G sequences)

    • These repeats may function similarly to those in tpr genes where "changes in the length of the poly-G repeats modulate the activity of promoters"

  • Experimental Validation Approach:

    • Construct reporter plasmids containing the TP_0381 promoter region fused to reporter genes (GFP or luciferase)

    • Generate variants with different poly-G repeat lengths

    • Measure promoter activity in heterologous expression systems (e.g., E. coli)

  • Transcriptional Analysis:

    • Perform quantitative real-time RT-PCR to measure TP_0381 expression levels in different T. pallidum strains

    • Compare expression patterns across different growth conditions and infection stages

    • Identify potential transcriptional regulators using pull-down assays with the promoter region

  • Phase Variation Assessment:

    • Investigate whether TP_0381 undergoes phase variation similar to tpr genes

    • Apply fragment length fluorescent analysis (FFLA) techniques to measure length polymorphisms in homopolymeric tracts

This approach builds on findings that homopolymeric G sequences can influence gene expression in T. pallidum, potentially contributing to immune evasion mechanisms.

  • How does TP_0381 compare to other potential diagnostic antigens for syphilis detection?

TP_0381 represents one of several T. pallidum antigens with potential diagnostic utility. Comparative analysis reveals:

AntigenSensitivitySpecificityStage DetectionReference
Tp0117 (TprC)High95-98%All stages
Tp0574Moderate>94%Early/late
Tp0769High (IgM: 91%, IgG: 98.3%)94.3-100%All stages
Tp1031 (TprL)Variable (stage-dependent)HighVariable
TP_0381Requires characterizationRequires characterizationUnknown

Research methodology to evaluate TP_0381 as a diagnostic antigen should include:

  • Immunoreactivity Testing:

    • Screen sera from patients at different stages of syphilis infection

    • Compare reactivity across different patient populations (primary, secondary, latent syphilis)

    • Assess cross-reactivity with other spirochete infections

  • Epitope Mapping:

    • Identify immunodominant epitopes using peptide arrays

    • Determine conservation of these epitopes across T. pallidum strains

    • Design optimized recombinant constructs containing key epitopes

  • Multiplex Assay Development:

    • Include TP_0381 in antigen panels alongside established markers

    • Evaluate whether inclusion improves diagnostic sensitivity/specificity

    • Assess performance in early and late disease stages

This comparative approach would determine if TP_0381 could enhance the "minimal array of Treponema pallidum antigens as biomarkers for syphilis diagnosis, infection staging, and response to treatment" .

  • What approaches can be used to determine if TP_0381 is surface-exposed and accessible to antibodies?

Determining surface exposure of TP_0381 is crucial for understanding its potential role in host-pathogen interactions and as a vaccine candidate. A multifaceted approach is recommended:

  • Whole-Cell ELISA with Intact Organisms:

    • Immobilize intact T. pallidum on microplate wells

    • Probe with anti-TP_0381 antibodies

    • Compare binding to known surface (positive control) and subsurface (negative control) proteins

  • Surface Proteolysis Accessibility:

    • Treat intact organisms with proteases that cannot penetrate the outer membrane

    • Analyze TP_0381 degradation by Western blotting

    • Protected proteins are likely subsurface, while degraded proteins are surface-exposed

  • Immunofluorescence Microscopy:

    • Perform immunofluorescence microscopy on fixed but non-permeabilized organisms

    • Compare labeling patterns with and without membrane permeabilization

    • Co-localize with known surface markers

  • Flow Cytometry-Based Analysis:

    • Apply flow cytometric methods similar to those used for GFP+ T. pallidum

    • Assess antibody binding to intact organisms

    • Measure membrane disruption using fluorescent dyes

Surface-exposed proteins are prime candidates for vaccine development, as they are accessible to antibodies that could facilitate opsonophagocytosis, an important clearance mechanism for T. pallidum during infection .

  • How can genetic tools be used to investigate the function of TP_0381 in Treponema pallidum?

Recent advances in genetic manipulation of T. pallidum provide unprecedented opportunities to study TP_0381 function. A comprehensive genetic investigation should include:

  • Gene Knockout/Knockdown Strategy:

    • Utilize newly developed genetic tools for T. pallidum

    • Create conditional knockdown systems if complete knockout is lethal

    • Compare growth and virulence phenotypes between wild-type and mutant strains

  • Complementation Analysis:

    • Reintroduce wild-type or mutated versions of TP_0381 into knockout strains

    • Assess restoration of phenotype to confirm gene-function relationship

    • Introduce tagged versions for localization studies

  • Protein Fusion Approaches:

    • Generate reporter fusions (similar to GFP fusions described in )

    • Study protein localization and expression dynamics during infection

    • Track protein-protein interactions using split reporter systems

  • Expression of Variant Alleles:

    • Introduce point mutations in conserved domains

    • Assess effects on protein function and bacterial phenotype

    • Identify critical residues for protein function

These approaches build on recent breakthroughs where researchers "took advantage of recent advances in in vitro cultivation and genetic manipulation of syphilis spirochetes to engineer a TPA strain that constitutively expresses green fluorescent protein" , demonstrating the feasibility of genetic manipulation in this historically challenging organism.

Methodological Research Questions

  • What host-pathogen interaction models are most appropriate for studying TP_0381 function?

Several experimental models can be employed to study TP_0381's role in host-pathogen interactions:

  • In Vitro Cell Culture Systems:

    • Human dermal fibroblasts: Model for primary infection site interactions

    • Human umbilical vein endothelial cells (HUVECs): Model for vascular dissemination

    • Human brain microvascular endothelial cells: Model for blood-brain barrier passage

    • Bone marrow-derived macrophages: Model for immune cell interactions

  • Ex Vivo Tissue Explants:

    • Skin explant culture: Maintains tissue architecture for studying invasion

    • Placental explants: Model for congenital transmission

    • Testicular tissue: Reflects natural infection environment

  • Animal Models:

    • Rabbit model: Most established model for T. pallidum infection

    • Requirements include:

      • SPF animals

      • Temperature-controlled environment (maintaining testicular temperature below core body temperature)

      • Careful monitoring for immune response development

  • Multi-Omic Analysis:

    • Apply approaches similar to those described in "Syphilis and the host: multi-omic analysis of host cellular responses"

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Compare wild-type and TP_0381 mutant strains when available

The most informative approach combines multiple models, starting with in vitro screening followed by validation in more complex systems. Recent studies have demonstrated the utility of "GFP+ strain to visualize TPA interactions with host cells during co-cultivation in vitro, within infected rabbit testes, and following opsonophagocytosis by murine bone marrow-derived macrophages" .

  • How can computational methods be used to predict TP_0381 function and prioritize experimental approaches?

Computational biology offers powerful tools to guide experimental characterization of uncharacterized proteins like TP_0381:

  • Integrative Bioinformatic Pipeline:

    • Sequence similarity networks: Connect TP_0381 to proteins of known function

    • Gene neighborhood analysis: Examine genomic context for functional clues

    • Protein domain prediction: Identify conserved domains and motifs

    • Structural modeling: Generate 3D models using AlphaFold or similar tools

    • Molecular dynamics simulations: Predict dynamic behavior and binding interfaces

  • Machine Learning Approaches:

    • Train models on characterized membrane proteins to predict TP_0381 function

    • Use feature extraction from sequence, structure, and genomic context

    • Implement ensemble methods to improve prediction accuracy

  • Molecular Docking Studies:

    • Screen potential ligands in silico

    • Predict protein-protein interactions

    • Generate hypotheses for experimental validation

  • Systems Biology Integration:

    • Place TP_0381 in the context of T. pallidum protein-protein interaction networks

    • Predict functional associations based on co-expression patterns

    • Identify potential regulatory elements controlling expression

This approach mirrors strategies used for other uncharacterized proteins, such as "Deep Green proteins" where "bioinformatic, genomic, and structural predictions were performed to begin classifying Deep Green genes and proteins" . For TP_0381, structural predictions using AlphaFold followed by comparison to known structures might reveal whether this protein possesses novel folds, similar to findings that "a significant proportion of Deep Green proteins may possess novel folds" .

Technical Research Questions

  • What are the challenges in expressing and purifying TP_0381 for structural studies, and how can they be overcome?

Membrane proteins like TP_0381 present significant challenges for structural biology. A systematic approach to overcome these includes:

  • Expression Optimization Strategies:

    • Codon optimization for the expression host

    • Testing multiple fusion tags (His, MBP, SUMO, GST)

    • Screening different expression vectors with varying promoter strengths

    • Using specialized membrane protein expression strains (e.g., C41(DE3), C43(DE3))

    • Temperature optimization (typically lower temperatures improve folding)

  • Solubilization and Purification Protocol:

    • Screen multiple detergents using a systematic approach:

    Detergent ClassExamplesBest For
    Non-ionicDDM, OG, Triton X-100Initial extraction
    ZwitterionicLDAO, FC-12Crystallization
    Steroid-basedDigitonin, GDNNative-like environment
    Novel amphipolsA8-35, PMAL-C8Detergent-free stabilization
    • Implement two-step purification at minimum (affinity + size exclusion)

    • Consider on-column detergent exchange during purification

  • Stability Enhancement Approaches:

    • Screen lipids as additives during purification

    • Test thermostabilizing mutations

    • Consider protein engineering to remove flexible regions

  • Alternative Structural Biology Methods:

    • Cryo-electron microscopy (less dependent on crystal formation)

    • Solid-state NMR (applicable to membrane proteins)

    • Hydrogen-deuterium exchange mass spectrometry (for dynamic regions)

These technical approaches should be tailored to the specific properties of TP_0381, starting with small-scale expression tests and gradually scaling up successful conditions.

  • How can I design and validate a serological assay specific for TP_0381 antibodies in syphilis patients?

Developing a specific and sensitive serological assay for TP_0381 requires careful design and validation:

  • Assay Platform Selection:

    • ELISA: Standard for high-throughput screening

    • Luminex/bead-based: Allows multiplexing with other antigens

    • Lateral flow: For point-of-care applications

    • Western blot: For confirmation testing

  • Antigen Preparation:

    • Use full-length recombinant TP_0381 for maximum epitope coverage

    • Consider peptide fragments representing immunodominant epitopes

    • Engineer constructs to express correctly folded extracellular domains

  • Validation Protocol:

    • Utilize serum panels:

      • Well-characterized syphilis patients (various stages)

      • Non-syphilis controls

      • Patients with related spirochetal infections (Lyme disease, leptospirosis)

      • Patients with conditions causing false positives in syphilis tests

  • Statistical Analysis Plan:

    • Determine sensitivity, specificity, positive and negative predictive values

    • Establish ROC curves to optimize cutoff values

    • Calculate likelihood ratios for test interpretation

  • Longitudinal Evaluation:

    • Assess antibody kinetics during infection and after treatment

    • Compare TP_0381 antibody patterns to established markers like Tp0769, Tp0117, and Tp0574

    • Evaluate potential as a serological marker of treatment response

This approach builds on methodologies used for other T. pallidum antigens, where researchers observed variable decreases in reactivity post-treatment, ranging from 5.1% (Tp0859) to 16% (Tp0769) .

  • What methodology is most effective for studying TP_0381 transcriptional regulation during syphilis infection?

To comprehensively analyze TP_0381 transcriptional regulation during infection:

  • Quantitative Expression Analysis:

    • RT-qPCR: For relative quantification across conditions

    • RNA-Seq: For genome-wide expression patterns

    • NanoString technology: For direct counting without amplification bias

  • Promoter Characterization:

    • Map transcriptional start site(s) using 5' RACE

    • Identify regulatory elements using reporter fusion constructs

    • Analyze homopolymeric tracts (particularly poly-G sequences)

    • Apply fragment length fluorescent analysis (FFLA) to measure length polymorphisms in homopolymeric tracts

  • In Vivo Expression Monitoring:

    • Reporter strains expressing fluorescent/luminescent proteins from the TP_0381 promoter

    • Tissue sampling during infection progression

    • Single-cell analysis to detect population heterogeneity

  • Environmental Regulation Studies:

    • Test expression under varying conditions:

      • Temperature shifts (37°C vs. 34°C)

      • Oxygen tension

      • pH variations

      • Immune factors (cytokines, antimicrobial peptides)

This methodology is informed by studies on related genes like tprL, where "experimental identification of the tprL transcriptional start site revealed that a homopolymeric G sequence of varying length resides within the tprL promoter and that its length affects promoter activity compatible with phase variation" . Similar mechanisms might regulate TP_0381 expression.

Concluding Research Question

  • How can I integrate studies of TP_0381 into broader investigations of syphilis pathogenesis and vaccine development?

Integrating TP_0381 research into broader syphilis investigations requires a multidisciplinary approach:

  • Contribution to Pathogenesis Understanding:

    • Establish TP_0381's role in specific aspects of infection:

      • Initial attachment to host cells

      • Immune evasion mechanisms

      • Tissue invasion and dissemination

      • Persistence in untreated infection

  • Vaccine Development Pipeline Integration:

    • Assess TP_0381 as potential vaccine antigen based on:

      • Surface exposure

      • Conservation across T. pallidum strains

      • Immunogenicity during natural infection

      • Ability to induce opsonophagocytosis

    • Combine with other antigens in multivalent formulations

  • Diagnostic Applications Development:

    • Incorporate into multiplex diagnostic panels

    • Evaluate as marker for specific infection stages

    • Assess potential for monitoring treatment response

  • Collaborative Research Framework:

    • Establish material sharing protocols

    • Standardize experimental methods across laboratories

    • Integrate data using common bioinformatic pipelines

    • Coordinate clinical sample collection and characterization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.