Recombinant Treponema pallidum Uncharacterized protein TP_0480 (TP_0480)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your use.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
TP_0480; Uncharacterized protein TP_0480
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0480
Target Protein Sequence
MIRALFSLFRSLHANTHPADLAHAAALALALALLPRSSLLWYLLFAVCFFIRLNRGLLLL SLVLFGFVVPSFDPWLDSLGNWALCLPRLQPVYRALIEIPFVGLARFYNTMIAGGLVAGA LCYLPCYALARCAVTAYRTYLYPKIHHATIFFLVRNAPLCKR
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0480

STRING: 243276.TP0480

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant TP_0480?

Multiple expression systems can be employed for TP_0480 production, each with distinct advantages:

Expression SystemHost OptionsAdvantagesLimitations
E. coliBL21(DE3), JM115, Rosetta-GAMIHigh yield, cost-effective, rapid productionLimited post-translational modifications
YeastSMD1168, GS115, X-33Some eukaryotic modifications, good secretionPotential hyperglycosylation
Insect cellsSf9, Sf21, High FiveBetter post-translational modificationsMore technically demanding
Mammalian cells293, 293T, CHO, COS-7Most authentic modificationsHighest cost, lower yield

Most commonly, TP_0480 is expressed in E. coli systems with an N-terminal His-tag for purification purposes . Selection should be based on specific research requirements, particularly if studying potential post-translational modifications.

What are the optimal storage and handling conditions for recombinant TP_0480?

For maximum stability and activity of recombinant TP_0480:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing as this significantly reduces protein stability

The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . It's advisable to briefly centrifuge the vial before opening to bring contents to the bottom.

How can the purity and identity of recombinant TP_0480 be verified?

Multiple analytical methods should be employed to verify recombinant TP_0480:

  • SDS-PAGE: Standard purity assessment, typically showing >90% purity

  • Western blotting: Using anti-His antibodies (for His-tagged protein) or specific anti-TP_0480 antibodies

  • Mass spectrometry: For accurate molecular weight determination and sequence verification

  • N-terminal sequencing: To confirm the correct start of the protein

  • Dynamic light scattering: To assess homogeneity and aggregation state

  • Circular dichroism: To evaluate secondary structure content

Combining these methods provides comprehensive characterization and ensures the protein meets quality requirements for downstream applications.

What are the reconstitution recommendations for lyophilized TP_0480?

For optimal reconstitution of lyophilized TP_0480:

  • Allow the vial to equilibrate to room temperature before opening

  • Briefly centrifuge to collect material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Mix gently by inversion or gentle pipetting (avoid vortexing)

  • For long-term storage, add glycerol to a final concentration of 5-50%

  • Aliquot into smaller volumes to minimize freeze-thaw cycles

Proper reconstitution is critical for maintaining protein structure and function. The recommended buffer for storage is Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

What methodologies are recommended for studying protein-protein interactions involving TP_0480?

Several complementary approaches can be employed to investigate TP_0480 interactions:

  • Co-immunoprecipitation (Co-IP):

    • Similar to approaches used for TSHR-CD40 protein interactions

    • Can pull down TP_0480 along with binding partners using specific antibodies

    • Western blot analysis confirms the interaction

  • Yeast two-hybrid screening:

    • Use TP_0480 as bait to screen for interacting proteins

    • Validate positive hits with orthogonal methods

  • Surface plasmon resonance (SPR):

    • Immobilize purified TP_0480 on sensor chips

    • Measure real-time binding kinetics with potential partners

  • Proximity labeling:

    • Fuse TP_0480 to BioID or APEX2

    • Identify proximally located proteins via mass spectrometry

  • Matched pairs experimental design:

    • Implement proper controls and randomization

    • Use statistical analysis to validate significance of interactions

When investigating membrane proteins like TP_0480, detergent selection is critical for maintaining native conformation during solubilization. Consider mild detergents like DDM or CHAPS to preserve protein-protein interaction capabilities.

How can researchers investigate the potential role of TP_0480 in T. pallidum pathogenesis?

Investigating TP_0480's role in pathogenesis requires multifaceted approaches:

  • Comparative genomics:

    • Compare TP_0480 sequence conservation across Treponema species

    • Analyze presence/absence in pathogenic versus non-pathogenic strains

  • Expression analysis:

    • Measure TP_0480 expression during different infection stages

    • Compare expression under various environmental conditions

  • Functional studies:

    • Generate recombinant TP_0480 with various tags for localization studies

    • Develop antibodies against TP_0480 for immunolocalization

    • Assess binding to host components (ECM proteins, cell surface receptors)

  • Immunological significance:

    • Evaluate immunogenicity in syphilis patients

    • Determine if antibodies against TP_0480 are bactericidal or neutralizing

    • Assess cross-reactivity with host proteins

  • Potential as a diagnostic marker:

    • Compare TP_0480 with existing diagnostic antigens used in treponemal tests

    • Evaluate specificity compared to established methods like TP-PA

Given that TP_0480 is uncharacterized, systematic investigation could yield novel insights into T. pallidum pathogenesis mechanisms.

What approaches can be used to characterize the structure-function relationship of TP_0480?

Understanding structure-function relationships requires integrated approaches:

  • Computational analysis:

    • Sequence analysis and homology modeling

    • Transmembrane topology prediction

    • Molecular dynamics simulations

  • Structural biology methods:

    • X-ray crystallography (challenging for membrane proteins)

    • NMR spectroscopy for solution structure

    • Cryo-electron microscopy for membrane context

  • Directed mutagenesis:

    • Site-directed mutagenesis of conserved residues

    • Generation of truncation mutants

    • Domain swapping with related proteins

  • Functional mapping:

    • Expression of specific domains separately

    • Assessment of individual domain functions

    • Identification of critical binding motifs

  • Post-translational modification analysis:

    • Mass spectrometric identification of modifications

    • Mutational analysis of modified residues

    • Functional impact of modifications

These approaches should be integrated to build a comprehensive model of how TP_0480's structure relates to its biological function in T. pallidum.

How should experiments be designed to investigate potential post-translational modifications of TP_0480?

Post-translational modifications (PTMs) investigation requires specialized approaches:

  • Expression system selection:

    • E. coli: Limited PTMs but useful as baseline

    • Eukaryotic systems: More complex modification patterns

    • Compare PTM profiles across different expression systems

  • Mass spectrometry analysis:

    • Enrichment strategies for specific modifications

    • Multiple fragmentation methods (CID, ETD, HCD)

    • Top-down proteomics for intact protein analysis

  • Modification-specific detection:

    • Phosphorylation: Phospho-specific antibodies, Phos-tag gels

    • Glycosylation: Lectin blotting, glycosidase treatments

    • Lipidation: Click chemistry with lipid analogs

  • Functional significance assessment:

    • Site-directed mutagenesis of modified residues

    • Comparison of modified vs. unmodified protein activity

    • Localization studies with mutants lacking modification sites

Understanding PTMs may provide crucial insights into TP_0480 regulation and function, particularly if modifications occur during different stages of infection.

What considerations should be made when developing TP_0480-based diagnostic assays for syphilis?

When evaluating TP_0480 as a potential diagnostic target:

  • Assay format selection:

    • ELISA-based methods

    • Lateral flow immunoassays

    • Particle agglutination (similar to existing TP-PA)

  • Performance considerations:

    • Cross-reactivity with other spirochetes

    • Sensitivity in different disease stages

    • Specificity against potential interfering conditions

  • Clinical validation:

    • Testing against well-characterized serum panels

    • Comparison with established methods (TP-PA, RPR)

    • Evaluation in different patient populations

  • Limitations to consider:

    • Like other treponemal tests, TP_0480-based assays would likely remain reactive after treatment

    • May not distinguish between active infection and past treated syphilis

    • Could be reactive in patients from areas endemic for yaws or pinta

    • Potential false-positives in conditions like HIV, leprosy, or toxoplasmosis

  • Implementation considerations:

    • Need for complementary non-treponemal testing (e.g., RPR)

    • Quality control requirements

    • Comparison with existing treponemal tests

Current diagnostic recommendations suggest TP-PA should not be used for general screening purposes, and similarly, any TP_0480-based assay would need to fit appropriately into diagnostic algorithms .

How does the E3 ubiquitin ligase system relate to research on T. pallidum proteins like TP_0480?

While direct evidence linking TP_0480 to ubiquitination is not established in the provided references, understanding this system is relevant for T. pallidum protein research:

  • Potential regulatory mechanism:

    • E3 ubiquitin ligases determine substrate specificity in ubiquitination pathways

    • T. pallidum proteins may be targeted by host ubiquitination machinery

  • Experimental approaches:

    • Investigate if TP_0480 is ubiquitinated during infection

    • Identify putative ubiquitination sites through bioinformatic prediction

    • Study TP_0480 stability in presence of proteasome inhibitors

  • Host-pathogen interaction:

    • T. pallidum may modulate host ubiquitination pathways

    • Bacterial proteins might interfere with host E3 ligases

    • Ubiquitination could affect immune recognition of T. pallidum antigens

  • Functional consequences:

    • Ubiquitination can signal for proteasomal degradation

    • It may also regulate other processes like transcription and DNA repair

    • Understanding these processes could reveal survival mechanisms of T. pallidum

Research on ubiquitination of T. pallidum proteins represents an important avenue for understanding host-pathogen interactions and developing novel therapeutic approaches.

What experimental design principles should be applied when evaluating TP_0480 function?

Robust experimental design is critical for TP_0480 functional studies:

  • Control implementation:

    • Include appropriate positive and negative controls

    • Use multiple independent methods to confirm findings

    • Implement blinding procedures where appropriate

  • Matched pairs design considerations:

    • Design experiments where samples serve as their own controls

    • Implement proper randomization strategies

    • Account for confounding variables

  • Statistical approaches:

    • Determine appropriate sample sizes through power analysis

    • Select suitable statistical tests based on data distribution

    • Account for multiple comparisons when necessary

  • Reproducibility measures:

    • Perform experiments with multiple technical and biological replicates

    • Validate findings using orthogonal methods

    • Document all experimental conditions thoroughly

  • Validation strategies:

    • Cross-validate findings across different experimental systems

    • Compare results with related proteins or homologs

    • Verify specificity using competitive inhibition or knockdown approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.