Recombinant Treponema pallidum Uncharacterized protein TP_0522 (TP_0522)

Shipped with Ice Packs
In Stock

Description

Research Applications and Context

While TP_0522 remains understudied, its availability as a recombinant protein positions it as a candidate for:

A. Functional Studies in T. pallidum Pathogenesis

  • Outer Membrane Interactions: Though not confirmed as an outer membrane protein (OMP), TP_0522’s full-length expression in E. coli facilitates studies on membrane localization or interactions with host cells.

  • Immune Evasion*: T. pallidum employs uncharacterized proteins to evade host immunity (e.g., TprK diversity, LPS transport homologs like Tp0515) . TP_0522 could be screened for similar roles.

Vaccine Development

Recombinant proteins like TpN17 and TpN47 are validated diagnostic antigens, with TpN47 showing 95.5% diagnostic accuracy in liquid microarray assays . TP_0522, while untested, could be evaluated as a candidate for serodiagnosis or immunoprotection.

Challenges and Knowledge Gaps

  • Functional Annotation: No studies directly link TP_0522 to metabolic pathways, virulence mechanisms, or host interactions.

  • Expression Patterns: Transcriptome data from T. pallidum infections indicate low expression (cDNA/DNA signal ratio = 0.27) compared to highly expressed genes like flaB3 (25.9) .

  • Conservation: Sequence analysis across T. pallidum subspecies (e.g., endemicum, pertenue) is unavailable, limiting insights into its evolutionary significance.

Comparative Analysis with Related Proteins

ProteinRole in T. pallidumRelevance to TP_0522
Tp0515LPS transport homolog; B-cell epitopes Potential for glycolipid transport or antigenicity, though TP_0522 lacks LPS association
TpN17Lipoprotein; diagnostic antigen TP_0522 could be evaluated for similar antibody reactivity in syphilis serology
Tp1038Bacterioferritin; iron uptake Possible involvement in nutrient acquisition, though no evidence for TP_0522’s role

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
TP_0522; Uncharacterized protein TP_0522
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0522
Target Protein Sequence
MTISTLDLILGIIMGIVTVRATMRGFVDEFFSKASILCAAVVAILCHKRLVPLTRVLLGH SILLPCITFLITFMGVYCVMLFLRSRMRTYATRDLISGFNQVFGFFFGIIEGSVLLTVIL LLLHVQPFVSVSHMLHESVINTVLSPLVLDGVRYMRLKM
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0522

STRING: 243276.TP0522

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant TP_0522?

Proper storage and handling of recombinant TP_0522 is crucial for maintaining protein integrity and experimental reproducibility. The protein is typically supplied as a lyophilized powder that requires specific handling procedures . For optimal results, researchers should:

  • Briefly centrifuge the vial before opening to ensure all content is at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard) for long-term storage

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep aliquoted samples at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they can compromise protein stability and activity

The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability .

What expression systems are most effective for TP_0522 production?

E. coli represents the most common and effective expression system for recombinant TP_0522 production . This approach offers several advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, Cost-effective, Rapid growth, Well-established protocolsPotential protein folding issues, Possible endotoxin contamination
CHO cellsMore complex post-translational modifications, Mammalian cell environmentSlower growth rate, Higher cost, Different yields based on cell cycle phase

When expressed in E. coli, the protein is typically fused to an N-terminal His tag to facilitate purification . This approach allows for efficient purification using nickel affinity chromatography. Researchers should be aware that although E. coli is effective, protein expression can be affected by various factors including cell growth conditions, induction parameters, and cellular stress.

Interestingly, research on other recombinant proteins has shown that modifying cell cycle progression through techniques such as caspase-7 knockout can enhance recombinant protein expression despite reduced cell proliferation rates . These findings might be applicable to TP_0522 expression optimization strategies when using mammalian cell systems.

How can genetic engineering techniques be applied to study TP_0522 function?

Recent advances in genetic engineering of Treponema pallidum have opened new avenues for functional studies of proteins like TP_0522. Until recently, the inability to genetically manipulate T. pallidum severely limited understanding of its pathogenesis mechanisms . Now, researchers can apply several approaches:

  • Gene Replacement/Knockout Studies: Using suicide vector constructs similar to those employed for tprA (tp0009) replacement with kanamycin resistance cassettes . This approach involves:

    • Constructing a suicide vector with a selectable marker (e.g., kanR)

    • Flanking the marker with ~1kb homology arms matching sequences adjacent to TP_0522

    • Introducing the construct into T. pallidum through transformation

    • Selecting transformants using appropriate antibiotics

  • CRISPR-Cas9 System: While not directly mentioned in the search results for T. pallidum, CRISPR techniques have been successfully applied to other bacteria and could potentially be adapted.

  • Heterologous Expression Systems: Expressing TP_0522 in model organisms to study its effects on various cellular processes and interactions with host proteins.

These approaches can help determine if TP_0522 is essential for bacterial survival, its role in pathogenesis, and potential interactions with host factors during infection.

What experimental designs are most appropriate for studying TP_0522?

When designing experiments to study TP_0522, researchers should consider comprehensive experimental design principles to ensure valid and reproducible results . A robust experimental design for TP_0522 characterization should include:

  • Clear Variable Definition:

    • Independent Variable (IV): Treatment conditions (e.g., different expression systems, mutations in the protein sequence)

    • Dependent Variable (DV): Measurable outcomes (e.g., protein yield, stability, binding affinity)

    • Controlled Variables: Factors kept constant (e.g., temperature, pH, buffer composition)

  • Appropriate Controls:

    • Positive controls (e.g., well-characterized proteins with similar properties)

    • Negative controls (e.g., buffer-only samples, unrelated proteins)

    • Vehicle controls when using solvents or carriers

  • Sufficient Replication:

    • Minimum of three biological replicates

    • Multiple technical replicates for each biological replicate

    • Statistical power analysis to determine appropriate sample size

  • Data Collection and Analysis Plan:

Data TypeCollection MethodAnalysis Approach
QuantitativeSpectrophotometry, ELISA, Western blot, Mass spectrometryStatistical tests (t-tests, ANOVA), Regression analysis
QualitativeVisual inspection, Microscopy, Gel imagingDescriptive analysis, Pattern recognition
  • Methodological Validation:

    • Preliminary experiments to establish assay sensitivity and specificity

    • Standard curves for quantitative measurements

    • Inter-observer reliability assessments for subjective measurements

This structured approach helps ensure experimental validity and facilitates troubleshooting if unexpected results occur .

How does cellular regulation affect the expression of recombinant proteins like TP_0522?

Cell cycle regulation significantly impacts recombinant protein expression, including proteins like TP_0522. Research has demonstrated that manipulating the cell cycle can enhance recombinant protein yields . Specifically:

  • Cell Cycle Arrest Effects: Studies show that caspase-7 deficiency induces G2/M phase arrest, which despite reducing cell proliferation, can increase recombinant protein expression by approximately 1.7-fold . This phenomenon is relevant when designing expression systems for TP_0522.

  • Proliferation vs. Expression Balance: There exists an inverse relationship between cell proliferation rate and per-cell protein expression capacity. Cells in certain arrested states allocate more resources to protein synthesis rather than division .

  • Checkpoint-Specific Effects: Different cell cycle checkpoints yield varying effects on protein expression:

    • G2/M arrest can increase expression by 1.5-1.7 fold for some proteins

    • G0/G1 checkpoint arrest has also been shown to improve recombinant protein expression

  • Practical Implementation: Researchers can deliberately induce cell cycle arrest through:

    • Genetic approaches (e.g., knockout of proliferation-related genes)

    • Chemical treatments (e.g., specific inhibitors)

    • Culture condition manipulation (temperature, serum levels)

When expressing TP_0522, researchers might consider these approaches to optimize yield, especially in mammalian expression systems where cell cycle manipulation has shown promising results.

What purification strategies are most effective for recombinant TP_0522?

Purification of His-tagged recombinant TP_0522 typically follows a multi-step process designed to maximize purity while maintaining protein integrity. Based on standard approaches for similar recombinant proteins:

  • Initial Capture:

    • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA resin

    • Binding buffer containing 20-50 mM imidazole to reduce non-specific binding

    • Elution with 250-500 mM imidazole gradient

  • Secondary Purification:

    • Size Exclusion Chromatography (SEC) to separate oligomeric states and remove aggregates

    • Ion Exchange Chromatography (IEX) based on theoretical pI of TP_0522

  • Quality Assessment:

    • SDS-PAGE analysis to confirm >90% purity as expected for properly purified TP_0522

    • Western blot with anti-His antibodies to confirm identity

    • Mass spectrometry for accurate molecular weight determination

  • Final Processing:

    • Buffer exchange to remove imidazole

    • Concentration to desired final concentration

    • Flash-freezing in liquid nitrogen with cryoprotectants (e.g., 6% Trehalose as mentioned in storage buffer)

Throughout the purification process, it's crucial to maintain appropriate temperature (typically 4°C) and add protease inhibitors to prevent degradation of the target protein.

How can researchers assess potential functions of TP_0522?

Given that TP_0522 remains uncharacterized, several methodological approaches can help elucidate its function:

  • Bioinformatic Analysis:

    • Sequence homology and phylogenetic comparisons

    • Structural prediction using AI-based tools (AlphaFold, RoseTTAFold)

    • Motif identification and domain analysis

  • Protein-Protein Interaction Studies:

    • Yeast two-hybrid screening

    • Pull-down assays using His-tagged TP_0522

    • Cross-linking followed by mass spectrometry

    • Surface plasmon resonance to measure binding kinetics

  • Functional Assays:

    • Location studies using fluorescently tagged protein

    • Knockout/knockdown phenotype analysis

    • Complementation studies

  • Structural Biology Approaches:

    • X-ray crystallography

    • Cryo-electron microscopy

    • NMR spectroscopy for dynamic studies

  • Host-Pathogen Interaction Studies:

    • Infection models with wild-type vs. TP_0522-modified T. pallidum

    • Host cell response assays

    • Immune recognition studies

These complementary approaches can provide converging evidence of TP_0522's biological role in T. pallidum and during syphilis pathogenesis.

What are common challenges in working with TP_0522 and how can they be addressed?

Researchers working with recombinant TP_0522 may encounter several technical challenges. Based on general experience with similar membrane-associated bacterial proteins and the available information:

ChallengePotential CausesSolutions
Low expression yieldProtein toxicity to host cells, Poor codon optimization, Inclusion body formationOptimize codon usage for expression host, Reduce induction temperature (16-25°C), Use specialized E. coli strains (Rosetta, BL21), Consider fusion partners (SUMO, MBP)
Protein insolubilityHydrophobic regions, Improper foldingAdd mild detergents (0.1% Triton X-100), Include solubilizing agents, Express with solubility tags
Protein degradationProtease activity, Thermal instabilityAdd protease inhibitors, Maintain samples at 4°C, Optimize buffer conditions, Process samples quickly
Poor binding to affinity resinTag inaccessibility, Interfering components in lysateTry different tag positions, Adjust binding conditions, Increase imidazole in wash buffers
Loss of activity after purificationDestabilizing buffer conditions, Critical cofactor absenceScreen buffer conditions, Include potential cofactors, Verify proper refolding

Additionally, cell cycle regulation during recombinant protein expression presents specific challenges. While caspase-7 deficiency has been shown to increase protein expression up to 1.7-fold, it comes with reduced cell proliferation . Researchers must balance these factors when optimizing expression systems.

How can researchers ensure experimental reproducibility when working with TP_0522?

Ensuring reproducibility in experiments involving TP_0522 requires systematic attention to multiple factors:

  • Standardized Protein Preparation:

    • Use consistent expression systems and conditions

    • Document lot-to-lot variation in commercial preparations

    • Characterize each preparation (purity, concentration, activity)

    • Implement quality control checkpoints before experiments

  • Detailed Methodological Documentation:

    • Maintain comprehensive laboratory notebooks

    • Record all experimental parameters, including:

      • Exact buffer compositions and pH

      • Incubation times and temperatures

      • Equipment settings and calibration status

      • Reagent sources, catalog numbers, and lot numbers

  • Statistical Rigor:

    • Determine appropriate sample sizes through power analysis

    • Implement randomization where applicable

    • Use blinding procedures for subjective assessments

    • Apply appropriate statistical tests with justified parameters

  • Validation Approaches:

    • Include multiple methodological approaches to test hypotheses

    • Verify key findings with orthogonal techniques

    • Test across different experimental models or systems

    • Consider independent replication within the laboratory

  • Data Management:

    • Implement FAIR principles (Findable, Accessible, Interoperable, Reusable)

    • Store raw data along with processed results

    • Use version control for analysis scripts

    • Maintain comprehensive metadata

By adhering to these principles, researchers can substantially improve the reproducibility of their work with TP_0522 and contribute more robustly to the scientific understanding of this protein.

What role might TP_0522 play in Treponema pallidum pathogenesis?

While TP_0522 remains uncharacterized, several research directions could illuminate its potential role in T. pallidum pathogenesis:

  • Structural Analysis: The amino acid sequence of TP_0522 suggests multiple hydrophobic regions, potentially indicating a membrane-associated function . Detailed structural studies could reveal:

    • Potential receptor-binding domains

    • Transmembrane regions

    • Structural homology to known virulence factors

  • Expression Patterns: Investigating when and where TP_0522 is expressed during different stages of infection could provide functional clues:

    • Early vs. late infection expression

    • Response to environmental stressors resembling host conditions

    • Tissue-specific expression patterns

  • Host Interaction Studies: Given that syphilis affects multiple organ systems and evades host immunity, TP_0522 might interact with host factors:

    • Immune evasion mechanisms

    • Tissue invasion and dissemination

    • Persistence strategies for long-term infection

  • Genetic Approaches: The recent development of genetic tools for T. pallidum opens new avenues to study TP_0522 :

    • Knockout/knockdown studies to assess virulence

    • Tag-based localization studies

    • Complementation experiments

  • Clinical Correlations: Analysis of TP_0522 expression or antibody responses across different patient populations and disease stages might reveal significant patterns .

Understanding TP_0522's role could contribute to our comprehension of T. pallidum's remarkable ability to establish persistent infection despite minimal nutritional independence and genetic capacity.

How might research on TP_0522 contribute to diagnostic or therapeutic approaches for syphilis?

Research on TP_0522 has significant potential to advance both diagnostic and therapeutic strategies for syphilis:

  • Diagnostic Applications:

    • Serological Tests: If TP_0522 proves immunogenic, antibodies against it could serve as biomarkers for specific disease stages

    • Molecular Diagnostics: TP_0522 sequences might provide targets for PCR-based detection with enhanced sensitivity or specificity

    • Point-of-Care Testing: Recombinant TP_0522 could be incorporated into rapid diagnostic tests

  • Therapeutic Targets:

    • If TP_0522 proves essential for pathogen survival, it could become a novel antibiotic target

    • Inhibitors of TP_0522 function could offer alternatives to penicillin for treatment-resistant cases

    • Peptide-based therapeutics derived from functional domains could disrupt host-pathogen interactions

  • Vaccine Development:

    • If surface-exposed, TP_0522 might serve as a vaccine antigen

    • Understanding TP_0522's role in immune evasion could inform immune response modulation strategies

    • Recombinant TP_0522 could be used in multi-antigen vaccine formulations

  • Translational Research Considerations:

Research FocusPotential ImpactChallenges
Structure-function analysisRational drug designMembrane protein structures are technically difficult
Immunogenicity studiesImproved serological diagnosticsCross-reactivity with commensals
Essential gene assessmentNew antibiotic targetsGenetic manipulation of T. pallidum remains challenging
Host interaction mappingNovel therapeutic approachesComplex host-pathogen dynamics

The syphilis epidemic persists worldwide despite available treatments, with high detection rates across multiple medical specialties . Novel approaches stemming from basic research on proteins like TP_0522 could significantly advance our ability to diagnose, treat, and potentially prevent this persistent infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.