Recombinant Treponema pallidum Uncharacterized protein TP_0572 (TP_0572)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquot the protein. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TP_0572; Uncharacterized protein TP_0572
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0572
Target Protein Sequence
MSALFSLVAVYVLVCALHKQIKKYASVCYLGSACVSVAVVCVVWSGATKGNFGVRVLLHP LTSASFSTAIFTFVMCASVLKNGLLKQRVMGLRAELAITAAILTLGHNIAHGRDYLVRLC GSTGDLSTGFLVAGAVSMVLVLLMSILAVTSFKVVRRRMGAKTWKRVQRLAYLFYGLTYV HLSFILLPTALRGYIPSVVSYVLYTVIFATYALLRVRKALGKRKGACALCSAAVAVSFVA FVLGASHMVRHTRRAHTERTTRAKARKCSPAEMKDGVYEASAQGHNGKLSLRVTISQGRI EAVTVVGHSDDDPYASWAVEGVSAAIVGAQSTDVDVVSEATSTSEAIIRAVEKILQQPQP
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0572

STRING: 243276.TP0572

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TP_0572 and where is it located in Treponema pallidum?

TP_0572 is an uncharacterized protein found in Treponema pallidum, the bacterial pathogen responsible for syphilis infection. According to available data, TP_0572 is classified as a putative integral membrane protein with a molecular structure that includes potential flavinylation sequence motifs . The protein consists of 360 amino acids and is expressed naturally in the Treponema pallidum bacterial system . While its precise subcellular localization requires further experimental confirmation, bioinformatic analyses suggest it is embedded within the cytoplasmic membrane, potentially serving as an interface for metabolic processes between the cytoplasm and periplasm.

The presence of potential flavinylation sequence motifs distinguishes TP_0572 as one of only two proteins in the treponemal genome identified with such characteristics, alongside TP0171 (a periplasmic lipoprotein) . This unique feature suggests TP_0572 may play a specialized role in flavin-dependent cellular processes within the bacterium.

What expression systems are currently used for producing recombinant TP_0572?

According to available research data, recombinant TP_0572 is primarily expressed using Escherichia coli as the host organism . The protein is typically produced with a histidine tag (His-tag) to facilitate purification through affinity chromatography techniques. The standard expression system yields full-length TP_0572 protein (amino acids 1-360) with the His-tag modification .

When selecting an expression system for TP_0572, researchers should consider several factors:

Expression System ComponentRecommended ParametersRationale
Host StrainE. coli (BL21 or derivatives)Well-established for membrane protein expression
VectorpET series or equivalentAllows for controlled induction
Tag LocationN-terminal or C-terminal His-tagFacilitates single-step purification
Expression Temperature16-30°CLower temperatures may improve folding of membrane proteins
Induction ProtocolIPTG (0.1-1.0 mM)Concentration optimization required for maximum yield

The expression of full-length TP_0572 presents typical challenges associated with membrane proteins, including potential toxicity to host cells and proper folding considerations. Optimizing induction timing, temperature, and media composition can significantly impact the quality and quantity of recombinant protein produced.

What are the structural characteristics of TP_0572?

TP_0572 is a full-length protein (1-360 amino acids) from Treponema pallidum . While detailed structural studies such as X-ray crystallography or NMR data are not yet available in the literature, bioinformatic analyses suggest TP_0572 contains transmembrane domains consistent with its classification as a putative integral membrane protein .

Significantly, TP_0572 contains potential flavinylation sequence motifs that may serve as attachment sites for flavin mononucleotide (FMN) . These motifs typically involve a threonine residue where FMN can be covalently attached through a phosphoester bond. The presence of these motifs suggests TP_0572 may function as a flavoprotein, utilizing the redox capabilities of FMN for its biological activity.

Comparative analysis with other bacterial proteins containing similar motifs indicates that TP_0572 may adopt a structure that positions the flavinylation site in a region accessible to flavin-trafficking proteins such as Ftp_Tp (TP0796), which has been shown to possess flavin transferase activity in Treponema pallidum .

What is known about the function of TP_0572 based on sequence homology?

Sequence homology analyses provide limited but valuable insights into the potential function of TP_0572. The protein contains flavinylation sequence motifs similar to those found in NqrC subunits of bacterial Nqr (Na⁺-translocating NADH:quinone oxidoreductase) redox systems . This similarity suggests that TP_0572 may participate in electron transport processes or redox reactions within Treponema pallidum.

Comparative genomic analysis reveals that while Treponema pallidum lacks a complete Nqr-type redox pump system, the oral spirochete Treponema denticola encodes a putative Nqr-type redox pump with an NqrC ortholog containing a flavinylation sequence motif . This evolutionary relationship suggests that TP_0572 may have evolved to perform specialized functions in Treponema pallidum's unique metabolic environment, potentially compensating for the absence of complete redox systems found in related organisms.

The potential involvement of TP_0572 in flavin-mediated processes is particularly significant considering Treponema pallidum's limited biosynthetic capabilities. The organism lacks many metabolic pathways and relies heavily on host-derived metabolites accessed through its periplasmic lipoprotein repertoire .

What is the potential role of TP_0572 in flavin metabolism in Treponema pallidum?

TP_0572's potential involvement in flavin metabolism represents a critical area for investigation, especially considering Treponema pallidum's parasitic lifestyle and limited biosynthetic capabilities. The presence of potential flavinylation sequence motifs in TP_0572 suggests it may function as a flavoprotein that participates in electron transfer processes . This function would be particularly important in Treponema pallidum, which lacks many biosynthetic pathways and relies on host-derived metabolites.

Recent research has identified a flavin-trafficking protein in Treponema pallidum (Ftp_Tp; TP0796) as the first bacterial metal-dependent flavin adenine dinucleotide (FAD) pyrophosphatase that hydrolyzes FAD into AMP and flavin mononucleotide (FMN) in the spirochete's periplasm . This enzyme also demonstrates Mg²⁺-dependent FMN transferase activity, capable of covalently attaching FMN to proteins containing appropriate sequence motifs .

Since TP_0572 contains potential flavinylation sequence motifs, it may serve as a substrate for Ftp_Tp-mediated flavinylation. This post-translational modification could enable TP_0572 to participate in electron transport processes, potentially contributing to the organism's energy metabolism or redox homeostasis despite its limited metabolic capabilities.

Given Treponema pallidum's inability to be cultivated in vitro, understanding the role of TP_0572 in flavin metabolism could provide valuable insights into the organism's survival strategies and potential vulnerabilities that could be targeted for therapeutic intervention.

How does the potential flavinylation of TP_0572 impact its function and stability?

The potential flavinylation of TP_0572 would constitute a significant post-translational modification with profound implications for the protein's function and stability. Covalent attachment of FMN to a threonine residue within TP_0572's flavinylation sequence motif would transform the protein into a flavoprotein capable of participating in electron transfer reactions .

Experimental evidence from related systems demonstrates that flavinylated proteins exhibit characteristic spectroscopic properties, including yellow coloration and UV-visible absorbance spectra with dual maxima at approximately 370 and 450 nm, with shoulders around 470 nm . These spectral properties serve as diagnostic indicators of successful flavinylation and proper flavin incorporation.

The covalent nature of the threonyl-FMN bond would enhance the stability of the flavin cofactor association compared to non-covalent flavin binding. This stability would be particularly advantageous in the dynamic periplasmic environment where Treponema pallidum must maintain functional proteins despite limited biosynthetic capabilities.

In terms of functional impact, flavinylation would likely enable TP_0572 to:

  • Participate in electron transfer processes

  • Contribute to redox homeostasis

  • Potentially interact with other components of membrane-associated electron transport systems

  • Function in the absence of continuously available soluble flavin cofactors

Research on analogous systems suggests the flavinylation process requires specific enzymatic machinery (such as Ftp_Tp) and is magnesium-dependent . The requirement for Mg²⁺ adds an additional regulatory dimension to this post-translational modification pathway.

What experimental approaches can definitively establish the flavinylation status of TP_0572?

Establishing the flavinylation status of TP_0572 requires a multi-technique approach that combines protein expression, spectroscopic analysis, and mass spectrometry. Based on methodologies successfully employed for similar proteins, the following experimental workflow would be optimal:

  • Co-expression system development: Establish an E. coli-based co-expression system for TP_0572 and Ftp_Tp (TP0796), similar to the systems used for TP0171 and NqrC_Td from Treponema denticola . This approach has successfully demonstrated flavinylation of target proteins in vivo.

  • Purification strategy: Following co-expression, purify the protein complex using affinity chromatography (Ni²⁺ affinity for His-tagged proteins) followed by gel filtration chromatography to separate flavinylated TP_0572 from the flavinylation enzyme Ftp_Tp .

  • Visual and spectroscopic confirmation: Successfully flavinylated TP_0572 should appear yellow after purification. Confirm flavinylation by UV-visible spectroscopy, looking for characteristic absorption maxima at ~370 and 450 nm with shoulders around 470 nm .

  • Mass spectrometric analysis: Perform quantitative time of flight mass spectrometry (Q-TOF MS) analysis to definitively identify the covalently bound flavin as FMN rather than FAD or riboflavin . The mass difference between flavinylated and non-flavinylated protein should correspond precisely to the molecular weight of FMN.

  • Site-specific validation: Conduct site-directed mutagenesis of the putative threonine residue within the flavinylation motif to confirm the exact attachment site. Mutation of this residue should abolish flavinylation without affecting protein expression.

This comprehensive approach would not only establish whether TP_0572 undergoes flavinylation but would also characterize the nature of the flavin attachment and identify the specific residue involved.

How does TP_0572 potentially interact with the flavin-trafficking protein Ftp_Tp (TP0796)?

The potential interaction between TP_0572 and the flavin-trafficking protein Ftp_Tp (TP0796) represents a fascinating aspect of Treponema pallidum's unique biochemistry. Research has demonstrated that Ftp_Tp possesses dual enzymatic activities: it functions as an Mg²⁺-dependent FAD pyrophosphatase that hydrolyzes FAD into AMP and FMN, and as an Mg²⁺-FMN transferase that covalently attaches FMN to proteins containing appropriate sequence motifs .

Given that TP_0572 contains potential flavinylation sequence motifs, it likely serves as a substrate for Ftp_Tp's FMN transferase activity. The interaction between these proteins would involve:

  • Recognition of target sequence: Ftp_Tp would recognize the specific flavinylation sequence motif in TP_0572, which typically contains a threonine residue that serves as the attachment point for FMN.

  • Magnesium-dependent catalysis: The flavinylation reaction catalyzed by Ftp_Tp is Mg²⁺-dependent, as demonstrated by inhibition with EDTA . The metal ion likely plays a crucial role in substrate binding and/or catalytic activity.

  • Transient interaction: Evidence from similar systems suggests that the enzyme-substrate interaction between Ftp_Tp and its target proteins is transient rather than forming stable complexes. Gel filtration chromatography of Ftp_Tp and its flavinylated products typically shows separate elution peaks rather than stable complexes .

  • Dual substrate mechanism: The flavinylation reaction likely involves FAD as the initial substrate, with Ftp_Tp first hydrolyzing FAD to generate FMN, which is then transferred to the threonine residue in TP_0572.

Understanding this potential interaction could provide valuable insights into how Treponema pallidum maintains a dynamic pool of flavin cofactors and generates flavoproteins locally in its periplasm, despite its limited biosynthetic capabilities .

What is the evolutionary significance of TP_0572 in the context of Treponema species?

The evolutionary context of TP_0572 provides fascinating insights into adaptive mechanisms within Treponema species. Comparative genomic analysis reveals intriguing differences between Treponema pallidum and related spirochetes regarding redox systems and flavoproteins.

Treponema denticola, an oral spirochete, encodes a putative Nqr-type redox pump with an NqrC subunit (NqrC_Td) containing a flavinylation sequence motif . In contrast, Treponema pallidum lacks a complete Nqr system but possesses proteins like TP_0572 with flavinylation motifs . This suggests evolutionary divergence in how these related organisms handle electron transport and redox processes.

The flavinylation mechanism itself shows evolutionary conservation, as demonstrated by cross-species functionality: Ftp_Tp from Treponema pallidum can flavinylate NqrC_Td from Treponema denticola, albeit with somewhat reduced efficiency . This conservation suggests the fundamental importance of this post-translational modification system across Treponema species.

Genome sequencing of different Treponema pallidum strains, such as those isolated from Ghana (CDC 2575 and Ghana-051), has revealed insights into the evolution rate of treponemes . Such comparative genomics approaches could potentially identify strain-specific variations in TP_0572 that might correlate with differences in virulence or host adaptation.

The presence of flavinylation systems in Treponema pallidum, despite its reduced genome and limited metabolic capabilities, underscores the essential nature of these systems for the organism's survival. TP_0572's retention in the genome suggests it plays a crucial role that has been maintained through evolutionary pressure, potentially related to the organism's unique parasitic lifestyle.

What techniques are recommended for studying the membrane topology of TP_0572?

Determining the membrane topology of TP_0572 requires specialized approaches suitable for bacterial membrane proteins. Based on current methodologies, a multi-technique strategy is recommended:

  • Computational prediction: Begin with in silico analysis using membrane protein topology prediction algorithms (TMHMM, MEMSAT, TopPred) to generate hypothetical models of TP_0572's transmembrane domains and orientation.

  • Fusion protein approach: Create fusion constructs with reporter proteins (such as PhoA, GFP, or LacZ) at various positions within TP_0572. The activity or fluorescence of these reporters depends on their cellular localization, providing experimental evidence for the topology model.

  • Substituted cysteine accessibility method (SCAM): Introduce cysteine residues at specific positions throughout TP_0572 and assess their accessibility to membrane-impermeable sulfhydryl reagents. This technique can distinguish which regions are exposed to the periplasm versus the cytoplasm.

  • Protease protection assay: Isolate membrane fractions containing TP_0572 and treat with proteases. Domains exposed on the surface will be digested while transmembrane and internal domains remain protected. Analysis of the resulting fragments by immunoblotting can reveal topological information.

  • Electron microscopy with immunogold labeling: Use antibodies against specific epitopes or tags inserted at various positions in TP_0572, coupled with gold nanoparticles for visualization by electron microscopy.

It's important to note that membrane protein topology studies often yield inconsistent results between methods. Therefore, a consensus approach utilizing multiple techniques is strongly recommended to establish a reliable topology model for TP_0572.

How can researchers study potential flavinylation of TP_0572 in vitro?

Investigating the potential flavinylation of TP_0572 in vitro requires a systematic approach that combines protein expression, enzymatic reactions, and analytical techniques. Based on successful methodologies employed with similar proteins, the following protocol is recommended:

  • Protein preparation:

    • Express and purify recombinant TP_0572 as a His-tagged protein from E. coli

    • Separately express and purify recombinant Ftp_Tp (TP0796), the putative flavinylating enzyme

    • Verify the absence of pre-existing flavinylation in purified TP_0572 by UV-visible spectroscopy

  • In vitro flavinylation reaction:

    • Establish reaction conditions containing purified TP_0572, Ftp_Tp, FAD as substrate, and Mg²⁺ (typically 5-10 mM MgCl₂)

    • Include appropriate controls: reaction without Mg²⁺, reaction with EDTA (to chelate Mg²⁺), reaction without Ftp_Tp, and reaction without FAD

    • Incubate at physiologically relevant temperature (37°C) for 1-2 hours

  • Detection and analysis of flavinylation:

    • Visual inspection for yellow coloration of TP_0572 after the reaction

    • UV-visible spectroscopy to detect characteristic flavin absorption peaks (~370 and 450 nm with shoulders around 470 nm)

    • SDS-PAGE analysis under denaturing conditions to verify covalent attachment (flavinylated proteins retain yellow coloration even under denaturing conditions)

    • Quantitative time of flight mass spectrometry (Q-TOF MS) to confirm the precise mass increase corresponding to FMN addition

Research has demonstrated that successful flavinylation is strictly Mg²⁺-dependent and requires both Ftp_Tp and FAD . EDTA strongly inhibits the flavin transferase activity, confirming the metal dependency of this reaction . The flavinylation proceeds through a two-step process where Ftp_Tp first hydrolyzes FAD to FMN and AMP, then transfers the FMN to a threonine residue in the target protein.

What experimental design would best elucidate the function of TP_0572 in Treponema pallidum?

Elucidating the function of TP_0572 in Treponema pallidum presents unique challenges due to the organism's inability to be cultivated in vitro. A comprehensive experimental approach must therefore utilize multiple complementary strategies:

  • Heterologous expression and functional reconstitution:

    • Express TP_0572 in a controllable system such as E. coli

    • Reconstitute the protein in liposomes or nanodiscs to maintain its native membrane environment

    • Test for specific biochemical activities (electron transfer, ion transport, etc.)

    • Assess interactions with other Treponema pallidum proteins, particularly those involved in redox processes

  • Structure-function analysis:

    • Generate a panel of TP_0572 variants with mutations in key regions, including the potential flavinylation site

    • Characterize these variants biochemically to identify essential residues

    • Attempt crystallization of TP_0572 (likely requiring specialized approaches for membrane proteins)

    • Utilize computational structural modeling informed by experimental constraints

  • Comparative genomics and transcriptomics:

    • Analyze expression patterns of TP_0572 across different growth conditions or infection stages

    • Compare with orthologous proteins in related organisms where function may be better characterized

    • Identify genes co-regulated with TP_0572 to establish potential functional associations

  • In vivo relevance assessment:

    • Generate antibodies against TP_0572 to confirm its expression during infection

    • Develop assays to detect flavinylated TP_0572 in Treponema pallidum isolated from infection models

    • Assess whether TP_0572 is recognized by the host immune system during infection

  • Protein-protein interaction studies:

    • Perform pull-down assays using tagged TP_0572 to identify binding partners

    • Confirm specific interactions using techniques such as surface plasmon resonance

    • Map interaction domains through truncation and mutation studies

This multi-faceted approach acknowledges the limitations of working with Treponema pallidum while maximizing information gleaned from complementary methodologies to build a comprehensive understanding of TP_0572's function.

How can site-directed mutagenesis be used to study the flavinylation motif in TP_0572?

Site-directed mutagenesis offers a powerful approach to dissect the structural requirements for flavinylation of TP_0572. Based on established methodology for studying similar post-translational modifications, the following experimental design is recommended:

This approach has proven effective in similar systems, such as the study of Ftp_Tp itself, where mutation of a metal-binding residue (D284A) eliminated its dual enzymatic activities , and where a single amino acid change (N55Y) converted Ftp_Tp from an Mg²⁺-dependent FAD pyrophosphatase to an FAD-binding protein .

What approaches can resolve contradictory data regarding TP_0572's cellular localization and function?

Resolving contradictory data regarding TP_0572's cellular localization and function requires a systematic approach combining multiple independent techniques and careful experimental design. Based on standard practices in resolving similar conflicts for membrane proteins, the following strategies are recommended:

  • Standardized preparation protocols:

    • Develop consistent protocols for membrane fractionation that clearly separate cytoplasmic, periplasmic, inner membrane, and outer membrane fractions

    • Validate fractionation quality using established marker proteins for each cellular compartment

    • Use multiple detergents with varying properties to solubilize TP_0572, as detergent choice can significantly impact membrane protein behavior

  • Orthogonal localization techniques:

    • Combine biochemical fractionation with fluorescence microscopy using GFP-tagged TP_0572 variants

    • Utilize electron microscopy with immunogold labeling for high-resolution localization

    • Perform protease accessibility assays under varied permeabilization conditions

    • Create a comprehensive topology map using substituted cysteine accessibility method (SCAM)

  • Functional reconciliation approaches:

    • Develop activity assays that can be performed in different cellular contexts

    • Test function in reconstituted systems with defined composition

    • Assess whether apparent functional differences could result from post-translational modifications or protein-protein interactions

  • Strain and condition variability assessment:

    • Evaluate localization and function across multiple Treponema pallidum strains

    • Test under varied environmental conditions that might trigger relocalization

    • Consider developmental or growth phase-dependent changes in localization

  • Integrated data analysis:

    • Employ statistical methods to assess the reliability of conflicting data

    • Weight evidence based on methodological rigor and reproducibility

    • Develop unified models that can account for apparently contradictory observations

By systematically addressing potential sources of variability and employing complementary methodologies, researchers can develop a consensus view of TP_0572's true localization and function that accommodates seemingly contradictory data within a coherent framework.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.