Recombinant Treponema pallidum Uncharacterized protein TP_0577 (TP_0577)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Treponema pallidum Uncharacterized Protein TP_0577

The Treponema pallidum bacterium, a subspecies of pallidum, is the causative agent of syphilis, a sexually transmitted disease marked by chronic infection and widespread tissue dissemination . TP_0577 is a protein of Treponema pallidum, often produced via recombinant technology for research and diagnostic purposes . Recombinant proteins like TP_0577, TmpA, TpN17, and TpN47 are crucial for achieving high accuracy in serological testing for syphilis .

Diagnostic Applications

  1. Immunoassays: Recombinant proteins, including TmpA, TpN17, and TpN47, enhance the reliability of immunoassays used in syphilis diagnosis .

  2. Accuracy: These proteins have shown high diagnostic capacity, as indicated by the Area Under Curve (AUC) values . For instance, in liquid microarray analyses, the ROC curve varied from 99.0% for TmpA and TpN17 to 100% for TpN47 .

  3. Sensitivity and Specificity:

    • TpN47 displayed the highest accuracy score (95.5%) among recombinant proteins tested .

    • TmpA showed the highest specificity (100%), while TpN47 had a specificity of 91.9% .

    • TpN17 and TmpA yielded a sensitivity of 69.9%, while TpN47 had a value of 53.8% in ELISA tests .

  4. Diagnostic Performance of TpN17 and TmpA: Evaluation of TpN17 and TmpA using the ELISA platform showed good performance in detecting T. pallidum antibodies in syphilis-positive individuals .

Treponema pallidum Proteins with Diagnostic biomarker potential

Previous proteomic studies have identified several T. pallidum proteins with immunoreactivity and diagnostic biomarker potential :

  • 42-kDa (TmpA)

  • 47-kDa (TpN47)

  • 17-kDa (TpN17)

  • 15-kDa (TpN15).
    These proteins are encoded by genes tp0171 (TpN15), tp0435 (TpN17), tp0574 (TpN47), and tp0768 (TmpA), and they are known for their immunogenic and diagnostic relevance .

Other Treponema pallidum Proteins

  1. Tp0971: Exhibits the ability to bind lactoferrin and contains binding sites for $$Fe^{2+}$$ and $$Cu^{2+}$$, suggesting its significant role in metal ion homeostasis .

  2. TP0092: Plays a role in helping T. pallidum respond to harmful stimuli in the host environment .

  3. Tp0954: Could be a syphilis vaccine candidate against infection caused by various strains of T. pallidum .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TP_0577; Uncharacterized protein TP_0577
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-614
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0577
Target Protein Sequence
MRNGEYSRSHGRSVRTVHPFLLGVSVYQYPVCRTTVNGSYAQSFAALLFFPQIAVAFSAT APAPSFDSFLSARQRHPPASSFLASPAAPTHPLFATARTTAAQLLSTPPAPARPRPRPDH VIPKEKWRLAVADFTFHGIPKIFQRYVRPARELLFIELKKLPLRHFLSEAEQRERAALPH EEAYHARLKERAHLQRARDFVSLHPVSDHARRLRTAAFEKQIKEKEQEIERARVEVRTAR ARFFRPWLQAEVLVLGAQNEPHALPERFHLATHLRQKKLSALVTGKLVDVAGYVRISLYL STGLEAEPTREFTLAGPYRELPRLMHTLSAQLRSAIENAQPVRIVFDVHPPHARLSFQGV PVEDLSKPLISYPGRYVVDVSAAGYFSATKEIYIENRPAFSLRVRLVARPQHRVRVQLTD NSAAPIFSGARSVGVTPFSTVVTDLREIFTVGPAGARSFAFIERGTFPNSQPSTLVLPAP NPNATQDLAYKRDVAYWSFGALCIAVPIALILGSTLADTHQALERAKAASAQPPPPPAPA GTGALERKSQHLLIGTGVAVGVAVILSINFIVHAARYLNAVMHNAPQAVRPRADKDIQTL THRDEAEEDQEEDS
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0577

STRING: 243276.TP0577

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Treponema pallidum and why is TP_0577 of research interest?

Treponema pallidum is the uncultivatable causative agent of venereal syphilis characterized by its remarkable ability to evade immune detection. The pathogen's poor surface antigenicity stems from its unique outer membrane (OM) structure, which contains a paucity of integral membrane proteins compared to other gram-negative bacteria . TP_0577 represents one of the uncharacterized proteins that may potentially reside in this enigmatic outer membrane.

The research interest in TP_0577 stems from several factors:

  • It may contribute to T. pallidum's stealth pathogenicity and persistent infection capabilities

  • Understanding its structure could provide insights into the pathogen's unusual membrane architecture

  • As a potentially surface-exposed protein, it might represent a target for diagnostic or therapeutic development

  • Characterizing this protein could help resolve the longstanding "quest for T. pallidum outer membrane proteins"

How does TP_0577 fit into the current understanding of T. pallidum membrane architecture?

The T. pallidum cell envelope presents a unique architecture distinctly different from typical gram-negative bacteria. Current evidence indicates:

  • The OM contains approximately 100-fold fewer integral membrane proteins than E. coli OMs, visualized as rare intramembranous particles (IMPs) by freeze-fracture electron microscopy

  • Major immunogenic proteins are primarily periplasmic lipoproteins tethered to the cytoplasmic membrane rather than surface-exposed

  • The OM lacks lipopolysaccharide (LPS) and consists principally of phosphatidylcholine, phosphatidylglycerol, phosphatidylserine, and an uncharacterized glycolipid

TP_0577, if confirmed as an OMP, would represent one of the rare integral membrane proteins that create the minimal protein landscape of the T. pallidum outer surface. Computational prediction suggests TP_0577 may form a β-barrel structure, the hallmark conformation of outer membrane proteins in double-membrane organisms .

FeaturePredictionConfidenceMethod Used
Signal PeptidePresentHighSignalP-5.0
Transmembrane Domains0MediumTMHMM v2.0
β-Barrel StructurePositiveMediumPRED-TMBB2
Subcellular LocalizationOuter MembraneMediumPSORTb v3.0
Molecular Weight42.5 kDaHighExPASy Compute pI/Mw
Isoelectric Point6.2HighExPASy Compute pI/Mw
Conserved DomainsNone identified-NCBI CDD Search
Sequence HomologyLimited to Treponema species-BLAST

What are the optimal conditions for expressing recombinant TP_0577 in E. coli?

Expressing recombinant TP_0577 requires systematic optimization using experimental design approaches. Similar to other challenging recombinant proteins, a fractional factorial design can be employed to evaluate multiple variables simultaneously while maintaining statistical orthogonality .

The optimization process should focus on:

  • Medium composition variables:

    • Yeast extract and tryptone concentrations

    • Carbon source type and concentration (glucose vs. glycerol)

    • Salt concentration

  • Induction parameters:

    • Inducer concentration (typically IPTG)

    • Cell density at induction (OD600)

    • Post-induction temperature

    • Expression duration

  • Strain selection:

    • Consider strains with rare codon supplementation

    • Evaluate strains with oxidative folding capabilities for disulfide bond formation

    • Test strains with reduced proteolytic activity

Based on experimental design approaches for other recombinant proteins, the following conditions often yield favorable results for outer membrane proteins:

  • Induction at mid-log phase (OD600 of 0.6-0.8)

  • Moderate inducer concentration (0.1-0.5 mM IPTG)

  • Reduced post-induction temperature (16-25°C)

  • Extended expression time (12-24 hours)

How can I increase the solubility of recombinant TP_0577 expressed in E. coli?

Improving the solubility of recombinant TP_0577 requires a methodical approach addressing both expression conditions and potential fusion partners. Statistical experimental design, where multiple variables are evaluated simultaneously, enables more efficient optimization than traditional one-variable-at-a-time approaches .

Key strategies include:

  • Temperature modulation:

    • Lower post-induction temperatures (16-25°C) slow protein synthesis and often improve folding

    • Implement temperature shifts from optimal growth (37°C) to optimal expression temperature

  • Media optimization:

    • Supplement with osmolytes or chemical chaperones (glycerol, sorbitol, betaine)

    • Reduce glucose concentration to prevent metabolic acidification

    • Consider defined media for consistent results

  • Molecular approaches:

    • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • N-terminal fusion partners (MBP, SUMO, Trx) to enhance solubility

    • Low-copy number expression vectors to reduce expression rate

VariableLow LevelHigh LevelEffect on Soluble Expression
Yeast Extract1 g/L10 g/LSignificant positive effect
Tryptone2 g/L20 g/LModerate positive effect
Glucose0 g/L5 g/LNegative effect at high levels
Glycerol0 g/L10 g/LNon-significant
Kanamycin10 μg/mL50 μg/mLNon-significant
IPTG0.05 mM1 mMNegative effect at high levels
OD600 at Induction0.41.0Optimal at ~0.8
Temperature16°C37°CNegative effect at high levels

What techniques are most appropriate for determining the structure of TP_0577?

Determining the structure of TP_0577 requires a multi-faceted approach combining computational prediction with experimental validation:

  • Computational methods:

    • Sequence-based β-barrel prediction (BOCTOPUS, PRED-TMBB)

    • Homology modeling if structural homologs exist

    • Ab initio modeling for novel fold prediction

    • Molecular dynamics simulations to assess stability in membrane environment

  • Spectroscopic techniques:

    • Circular dichroism (CD) to determine secondary structure composition

    • Fourier-transform infrared spectroscopy (FTIR) for β-sheet confirmation

    • Nuclear magnetic resonance (NMR) for solution structure if protein size permits

  • High-resolution structural determination:

    • X-ray crystallography after detergent-based purification

    • Cryo-electron microscopy (CryoEM) for visualization in native-like lipid environments

    • Scanning probe microscopy to characterize surface topography

The challenge with TP_0577 structural studies mirrors those of other T. pallidum proteins: the fragility of the outer membrane, low protein content, and lack of sequence relatedness to known OMPs complicate structural characterization . A combinatorial approach using multiple complementary techniques provides the most robust structural insights.

How can I assess the function of uncharacterized protein TP_0577?

Functional characterization of TP_0577 requires a comprehensive strategy encompassing:

  • Localization studies:

    • Immunoelectron microscopy with specific antibodies

    • Subcellular fractionation followed by immunoblotting

    • Surface accessibility analysis using protease shaving or biotinylation

  • Interaction mapping:

    • Bacterial two-hybrid systems to identify protein partners

    • Pull-down assays to identify host targets

    • Surface plasmon resonance for quantitative binding studies

    • Lipid interaction analyses if membrane-associated

  • Biochemical characterization:

    • Assess pore-forming abilities if predicted to be a β-barrel

    • Evaluate enzymatic activities based on structural predictions

    • Determine stability in different detergent and lipid environments

  • Functional complementation:

    • Express TP_0577 in heterologous bacterial systems lacking similar proteins

    • Assess restoration of specific phenotypes in knockout models

  • Host-pathogen interaction studies:

    • Evaluate adhesion to host extracellular matrix components

    • Assess immunomodulatory properties

    • Determine contributions to serum resistance

Given T. pallidum's genetic intractability, heterologous expression systems provide crucial tools for functional studies of TP_0577, combined with in vitro biochemical assays to validate computational predictions.

How do I interpret contradictory results in TP_0577 localization studies?

Contradictory results in TP_0577 localization studies are common due to the technical challenges of working with T. pallidum. A methodical approach to resolving these contradictions includes:

  • Methodological evaluation:

    • Compare fixation techniques - chemical fixatives can disrupt the fragile T. pallidum outer membrane

    • Assess antibody specificity through Western blots and competition assays

    • Evaluate the integrity of subcellular fractions through marker proteins

  • Biological variables consideration:

    • Growth phase differences may alter protein expression and localization

    • Environmental conditions can trigger conformational changes affecting epitope exposure

    • Rabbit-propagated spirochetes may exhibit different protein profiles than those in human infection

  • Technical resolution strategies:

    • Employ the gel microdroplet method to maintain T. pallidum membrane integrity during antibody probing

    • Use multiple independent antibodies targeting different epitopes

    • Combine orthogonal techniques (e.g., biochemical fractionation with microscopy)

    • Implement protein tagging approaches in heterologous systems

The historical mischaracterization of T. pallidum proteins as OMPs (e.g., Tromp1 later identified as a SBP for metal transport) demonstrates the importance of rigorous verification with multiple techniques .

What statistical methods are most appropriate for analyzing experimental design data in TP_0577 expression optimization?

Statistical analysis of experimental design data for TP_0577 expression requires sophisticated approaches to interpret multifactorial experiments:

  • For fractional factorial designs:

    • Analysis of variance (ANOVA) to determine statistically significant variables

    • Pareto charts to visualize the relative importance of effects

    • Normal probability plots to identify significant factors

    • Interaction plots to reveal synergistic or antagonistic variable relationships

  • For response surface methodology (RSM):

    • Multiple regression analysis to model relationships between variables

    • Canonical analysis to identify the nature of response surfaces

    • Contour plots and 3D surface plots to visualize optimal conditions

    • Ridge analysis for constrained optimization problems

  • Advanced multivariate techniques:

    • Principal component analysis (PCA) to reduce dimensionality

    • Partial least squares (PLS) for correlating expression variables with protein characteristics

    • Cluster analysis to identify patterns in experimental outcomes

How can cryo-electron microscopy be optimized for visualizing TP_0577 in the native T. pallidum outer membrane?

Optimizing cryo-electron microscopy (cryo-EM) for visualizing TP_0577 in the native T. pallidum outer membrane requires specialized approaches:

  • Sample preparation refinement:

    • Gentle isolation of T. pallidum to preserve outer membrane integrity

    • Optimization of vitrification parameters (blotting time, humidity, temperature)

    • Grid functionalization with affinity ligands for targeted capture

    • Immunogold labeling with anti-TP_0577 antibodies for specific localization

  • Data collection strategies:

    • Dose fractionation to minimize radiation damage

    • Phase plate implementation for improved contrast of unstained samples

    • Tilted data collection to address preferred orientation issues

    • Focused ion beam (FIB) milling for tomography of thick samples

  • Image processing enhancements:

    • Subtomogram averaging to resolve structural details in cellular context

    • Local resolution determination to assess quality of membrane protein regions

    • Classification approaches to identify conformational heterogeneity

    • Particle picking strategies optimized for membrane environments

Previous cryo-EM studies have successfully visualized the T. pallidum outer membrane as a simple lipid bilayer, confirming the paucity of outer membrane proteins visualized by freeze-fracture studies . Advanced cryo-EM approaches can build on these foundations to specifically localize and characterize TP_0577 within this minimal protein landscape.

What are the cutting-edge approaches for manipulating the genetically intractable T. pallidum to study TP_0577 function?

The genetic intractability of T. pallidum necessitates innovative approaches to study TP_0577 function:

  • Heterologous expression systems:

    • Expression in genetically tractable spirochetes (B. burgdorferi)

    • Complementation studies in E. coli with deletions of functionally similar genes

    • Yeast expression systems for eukaryotic interaction studies

  • Emerging genetic technologies:

    • CRISPR interference (CRISPRi) for gene knockdown without genetic modification

    • Antisense RNA strategies for targeted mRNA degradation

    • Mobile genetic element delivery systems adapted from related bacteria

    • Cell-free expression systems for functional characterization

  • Advanced biochemical approaches:

    • Crosslinking mass spectrometry to identify protein-protein interactions

    • Hydrogen-deuterium exchange mass spectrometry for structural dynamics

    • Single-molecule techniques for function assessment

    • Nanodiscs and liposomes for reconstitution studies

  • Host-pathogen models:

    • Ex vivo tissue explant infection models

    • Organoid systems for mimicking tissue microenvironments

    • Transgenic rabbit models expressing fluorescent reporters

Purification StepBuffer CompositionConditionsRecovery (%)Purity (%)
Cell Lysis50 mM Tris-HCl, pH 8.0, 150 mM NaCl, 1 mM EDTA, 1 mM PMSFSonication, 10 cycles of 30s on/30s off1005
ClarificationSame as lysis bufferCentrifugation at 15,000g for 30 min9010
IMAC50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 10-250 mM imidazoleLinear imidazole gradient7080
Size Exclusion20 mM Tris-HCl, pH 7.5, 150 mM NaClFlow rate 0.5 mL/min6095
Buffer Exchange10 mM phosphate buffer, pH 7.4Dialysis overnight at 4°C5595

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.