Recombinant Treponema pallidum Uncharacterized protein TP_0638 (TP_0638)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TP_0638; Uncharacterized protein TP_0638
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0638
Target Protein Sequence
MGTLRRFPASVLQIALALFLLASGARDLVHVDAGVFNAAVYFLGGLFRGHVAIGVLTLAV SLCCLTAGFFLLVDFLRPELSCVSAVLALFVVLWALNMVLVDVVGAFGRGKVLQNVSSAL EHLHHTAVDLLVLGALIFVRQHTR
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0638

STRING: 243276.TP0638

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TP_0638 and why is it significant in Treponema pallidum research?

TP_0638 is an uncharacterized protein from Treponema pallidum, the causative agent of syphilis. Its significance stems from several factors:

  • It belongs to a group of proteins that may contribute to T. pallidum pathogenesis

  • As an uncharacterized protein, it represents a knowledge gap in the comprehensive understanding of the T. pallidum proteome

  • Preliminary analysis suggests potential immunogenic properties, making it relevant for diagnostic and vaccine development research

  • The protein may be involved in host-pathogen interactions during infection

Understanding TP_0638 could contribute to the broader goals of syphilis research, including improved diagnosis, monitoring of treatment effectiveness, and potential vaccine development. The global burden of syphilis (18-56 million cases with 5.6-11 million new cases annually) underscores the importance of characterizing all T. pallidum proteins that could serve as diagnostic or therapeutic targets .

What expression systems are recommended for recombinant TP_0638 production?

For recombinant TP_0638 production, the following expression systems can be considered based on their advantages for treponemal protein expression:

Expression SystemAdvantagesLimitationsYield Expectation
E. coli BL21(DE3)- Fast growth
- High yield
- Cost-effective
- Well-established protocols
- May form inclusion bodies
- Lack of post-translational modifications
10-30 mg/L culture
E. coli Rosetta 2- Accommodates rare codons found in T. pallidum
- Improves expression of proteins with rare tRNA requirements
- Higher cost than standard BL21
- May still produce insoluble protein
8-25 mg/L culture
Baculovirus/Insect cells- Post-translational modifications
- Better protein folding
- Lower endotoxin levels
- Higher cost
- Longer production time
- More complex protocols
5-15 mg/L culture
Cell-free systems- Rapid expression
- Avoids toxicity issues
- Allows expression of difficult proteins
- Expensive
- Lower yield
- Limited scale-up potential
0.5-2 mg/mL reaction

Methodological approach: Begin with small-scale expression trials in E. coli systems (typically BL21 or Rosetta strains) with varying induction conditions (temperature, IPTG concentration, duration). Optimize solubility using fusion partners (MBP, SUMO, or TRX tags). If E. coli expression yields poorly soluble protein, transition to baculovirus/insect cell expression system which often improves the folding of treponemal proteins .

What purification strategies work best for recombinant TP_0638?

Purification of recombinant TP_0638 typically follows a multi-step approach to achieve high purity for downstream applications:

  • Affinity Chromatography: His-tag affinity is most common, using Ni-NTA or TALON resins with imidazole gradient elution

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-300 mM imidazole

    • Expected recovery: 70-85% of expressed soluble protein

  • Ion Exchange Chromatography: Second step to remove contaminants

    • Based on theoretical pI of TP_0638, select appropriate resin (Q-Sepharose for basic proteins, SP-Sepharose for acidic)

    • Gradient elution with increasing salt concentration (0-1 M NaCl)

  • Size Exclusion Chromatography: Final polishing step

    • Superdex 75 or 200 columns depending on expected molecular weight

    • Buffer composition: 20 mM Tris-HCl pH 7.5, 150 mM NaCl

  • Endotoxin Removal: Critical for immunological studies

    • Triton X-114 phase separation or commercial endotoxin removal resins

    • Target: <0.1 EU/μg protein

Storage recommendation: Store purified protein at -80°C in small aliquots with 10% glycerol to prevent freeze-thaw cycles. Validate purification success using SDS-PAGE, Western blot, and mass spectrometry for identity confirmation.

How can researchers assess the immunogenicity of TP_0638?

Assessment of TP_0638 immunogenicity requires a systematic approach:

  • Serum Reactivity Analysis:

    • Test recombinant TP_0638 against serum panels from:

      • Patients with different stages of syphilis (primary, secondary, latent, tertiary)

      • Healthy controls

      • Patients with other spirochetal infections (cross-reactivity assessment)

    • Utilize ELISA, Western blot, or protein array technologies for quantitative assessment

  • Epitope Mapping:

    • Synthesize overlapping peptides spanning TP_0638 sequence

    • Identify immunodominant regions through epitope mapping techniques

    • Correlate reactive epitopes with protein structural features

  • Longitudinal Serological Analysis:

    • Monitor antibody responses to TP_0638 before and after treatment

    • Track decline in reactivity as potential marker for treatment efficacy

    • Compare with established serological markers

The methodological approach should involve immunoassay development using purified recombinant TP_0638, with careful antibody titer measurements and statistical analysis of results across different patient groups. Recent studies have shown that reactivity to specific T. pallidum antigens can serve as potential biomarkers for disease staging and treatment monitoring .

What bioinformatic approaches can predict TP_0638 function?

Predicting TP_0638 function requires comprehensive bioinformatic analysis:

Analysis MethodToolsExpected OutcomesLimitations
Sequence homologyBLAST, HMMER, FASTAIdentification of homologous proteins with known functionsLimited by database annotations
Domain predictionInterProScan, SMART, PfamRecognition of conserved protein domains and motifsMay miss novel domains
Structural predictionAlphaFold2, I-TASSER, Phyre23D structure models indicating potential functional sitesAccuracy depends on template availability
Subcellular localizationPSORT, SignalP, TMHMMPrediction of cellular location (membrane, cytoplasm, etc.)May give contradictory results
Protein-protein interactionSTRING, STITCHPotential interaction partners suggesting functional networksLimited by known interactome data
Evolutionary analysisMEGA, PhyML, PAMLEvolutionary conservation indicating functional importanceRequires adequate homologous sequences

Methodological approach: Begin with sequence-based analysis to identify conserved domains and motifs. Generate structural models using AlphaFold2 to predict folding patterns and potential binding sites. Analyze surface properties and electrostatic potentials to identify interaction interfaces. Cross-reference predictions with experimental data from related treponemal proteins to establish functional hypotheses for experimental validation .

How does TP_0638 expression vary across different stages of syphilis infection?

Understanding the expression pattern of TP_0638 across different stages of syphilis requires:

  • Transcriptomic Analysis:

    • RT-qPCR measurement of TP_0638 mRNA levels from:

      • In vitro cultured T. pallidum under various stress conditions

      • Rabbit model samples at different infection stages

      • Human samples when available (limited by ethical constraints)

    • RNA-Seq to place TP_0638 expression in context of global gene expression changes

  • Proteomic Detection:

    • Develop specific antibodies against recombinant TP_0638

    • Immunohistochemistry of infected tissues

    • Western blot quantification from tissue extracts

    • Mass spectrometry-based proteomics to confirm protein expression

  • Comparative Expression Analysis:

    • Analyze expression patterns relative to known stage-specific markers

    • Correlate expression with pathological findings

    • Determine expression in response to antibiotic treatment

The expression pattern could indicate potential roles in specific infection stages. Methodological approach should include appropriate normalization controls, biological replicates, and statistical analysis to account for individual variations in host response .

What experimental approaches can resolve contradictory data on TP_0638 function?

Resolving contradictory functional data for TP_0638 requires a multi-faceted approach:

  • Systematic Literature Review and Meta-analysis:

    • Compile all published data on TP_0638

    • Categorize methodologies used in contradictory studies

    • Identify potential sources of variation (expression systems, purification methods, assay conditions)

  • Standardized Experimental Protocols:

    • Develop consensus protocols for protein production

    • Establish reference standards for activity assays

    • Create shared material resources (plasmids, antibodies, recombinant proteins)

  • Multi-laboratory Validation Studies:

    • Engage multiple research groups to perform identical experiments

    • Implement blinded analysis of results

    • Conduct statistical analysis of inter-laboratory variation

  • Orthogonal Methodology Application:

    • Test function using complementary techniques (biochemical, cellular, structural)

    • Compare in vitro and in vivo results

    • Validate findings across different experimental models

  • Data Integration Approach:

    • Apply machine learning to identify patterns in contradictory datasets

    • Use Bayesian analysis to weigh evidence from different methodologies

    • Develop predictive models that account for experimental variables

Experimental design should include appropriate positive and negative controls, dose-response relationships, and rigorous statistical analysis with consideration of both Type I and Type II errors. For cellular assays, phenotypic changes should be quantified using image analysis software following standardized parameters .

How can researchers design definitive experiments to characterize TP_0638 function?

Designing definitive experiments to characterize TP_0638 function requires a comprehensive strategy:

Experimental ApproachMethodologyExpected OutcomesCritical Controls
Gene knockout/knockdownCRISPR-Cas9 or conditional expression systemsPhenotypic changes indicating functionComplementation with wild-type gene
Protein-protein interactionCo-immunoprecipitation, yeast two-hybrid, proximity labeling, FRETIdentification of binding partnersNon-specific binding controls, confirmation by multiple methods
Structural biologyX-ray crystallography, Cryo-EM, NMRDetailed 3D structure revealing functional motifsValidation of protein folding and activity
Enzymatic activity assaysSubstrate screening, reaction kinetics, inhibitor studiesIdentification of biochemical functionHeat-inactivated protein, substrate specificity tests
Host cell interactionCell infection models, immune cell activation assaysRole in host-pathogen interactionHost cell viability controls, dose-response studies

Methodological approach: Begin with careful experimental design including positive controls (known T. pallidum protein with established function) and negative controls (unrelated protein or buffer). Implement a multi-technique validation strategy where each finding is confirmed using at least two independent methods. For immunological studies, ensure endotoxin contamination is eliminated to avoid false-positive inflammation responses. Statistical analysis should include appropriate sample sizes determined by power analysis, with blinded assessment of outcomes whenever possible .

What role might TP_0638 play in T. pallidum pathogenesis based on current evidence?

Based on limited available evidence and comparative analysis with other treponemal proteins, TP_0638 may contribute to pathogenesis through:

  • Immune Evasion Mechanisms:

    • Potential molecular mimicry with host proteins

    • Possible immunomodulatory effects on host immune cells

    • Antigenic variation contributing to persistent infection

  • Tissue Invasion and Dissemination:

    • Potential ECM-binding properties facilitating tissue penetration

    • Possible role in basement membrane degradation

    • Contribution to the characteristic invasiveness of T. pallidum

  • Metabolic Adaptation:

    • Role in nutrient acquisition within host environment

    • Adaptation to microaerophilic conditions in tissues

    • Potential contribution to stress response during infection

  • Potential Contribution to Inflammatory Response:

    • Induction of cytokine production by host cells

    • Modulation of neutrophil or macrophage activation

    • Influence on local tissue inflammation

Current experimental approach limitations include the inability to continuously culture T. pallidum in vitro and ethical constraints on human studies. Research would benefit from animal models (particularly rabbit models) combined with tissue-specific gene expression analysis and innovative approaches such as humanized mice for studying human-specific aspects of pathogenesis .

How can advanced data analysis methods improve interpretation of TP_0638 research findings?

Advanced data analysis methods can significantly enhance interpretation of TP_0638 research:

  • Integrative Omics Analysis:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Utilize systems biology approaches to place TP_0638 in functional networks

    • Apply pathway enrichment analysis to identify biological processes

  • Machine Learning Applications:

    • Develop prediction models for protein function based on multiple features

    • Apply unsupervised learning to identify patterns in experimental data

    • Use deep learning for image analysis in localization studies

  • Statistical Approaches for Contradictory Data:

    • Meta-analysis techniques to resolve conflicting results

    • Bayesian methods to update confidence in hypotheses as new data emerges

    • Sensitivity analysis to identify influential experimental parameters

  • Visualization Techniques:

    • Interactive data dashboards for complex experimental results

    • Network visualizations to represent protein interactions

    • Structural visualization integrated with functional data

Methodological approach: Implement reproducible research practices using computational notebooks (Jupyter, R Markdown) with version control. Apply appropriate statistical tests based on data distribution and experimental design. For high-dimensional data, use dimensionality reduction techniques (PCA, t-SNE, UMAP) followed by cluster analysis. Validate findings through both technical replicates (same biological sample) and biological replicates (different samples) .

How might TP_0638 be utilized in developing improved syphilis diagnostics?

TP_0638 has potential applications in next-generation syphilis diagnostics:

  • Multiplex Antigen Arrays:

    • Include TP_0638 alongside established antigens (e.g., Tp0435, Tp0574)

    • Develop diagnostic algorithms based on reactivity patterns

    • Enhance specificity through combined antigen profiling

  • Stage-Specific Diagnostic Development:

    • If TP_0638 shows differential reactivity across disease stages

    • Potential for distinguishing active from past infection

    • Integration into stage-specific diagnostic panels

  • Treatment Monitoring Applications:

    • Track antibody response to TP_0638 during and after therapy

    • Potential marker for treatment efficacy or failure

    • Development of quantitative assays for serological monitoring

  • Point-of-Care Test Integration:

    • Adaptation of TP_0638-based detection for field settings

    • Lateral flow assay development

    • Microfluidic diagnostic platforms

Current diagnostic approaches for syphilis combine treponemal and non-treponemal tests but have limitations in distinguishing active from past infection and monitoring treatment response. Including novel antigens like TP_0638 in diagnostic panels could improve specificity and stage determination. Methodological development would require extensive validation with well-characterized serum panels from different stages of infection and post-treatment follow-up samples .

What challenges exist in translating TP_0638 research to clinical applications?

Translating TP_0638 research to clinical applications faces several challenges:

Challenge CategorySpecific BarriersPotential Solutions
Technical Challenges- Scale-up production limitations
- Protein stability issues
- Assay standardization
- Optimize expression systems
- Engineering stabilized variants
- Develop reference standards
Clinical Validation- Limited access to well-characterized patient samples
- Ethical constraints on human studies
- Variation in host immune responses
- Multi-center biobanking initiatives
- Retrospective studies with stored samples
- Machine learning for heterogeneous data analysis
Regulatory Hurdles- Validation requirements for diagnostic use
- Quality control for recombinant proteins
- Clinical trial design complexity
- Early regulatory consultation
- Implementation of GMP production
- Adaptive clinical trial designs
Implementation Barriers- Cost considerations for resource-limited settings
- Integration with existing diagnostic workflows
- Laboratory capacity in endemic regions
- Simplified production methods
- Algorithm development for test interpretation
- Training programs for laboratory personnel

The methodological approach to overcome these challenges includes establishing international research consortia, developing standardized protocols, creating shared biorepositories, and implementing translational research pipelines that connect basic science discoveries to clinical development. Early engagement with regulatory agencies and potential end-users can help align research direction with practical implementation considerations .

How can researchers design experiments to evaluate TP_0638 as a vaccine candidate?

Evaluation of TP_0638 as a vaccine candidate requires a systematic experimental approach:

  • Antigenicity and Immunogenicity Assessment:

    • Determine conservation across T. pallidum strains

    • Evaluate antibody responses in natural infection

    • Measure T-cell responses to recombinant protein and peptides

  • Protective Immunity Studies:

    • Animal model immunization (rabbit model is standard)

    • Challenge studies with infectious T. pallidum

    • Quantification of protection metrics:

      • Lesion development

      • Treponeme burden in tissues

      • Dissemination to distant sites

  • Immune Correlates Analysis:

    • Characterize antibody isotypes, affinity, and neutralizing capacity

    • Identify T-cell subsets and cytokine profiles associated with protection

    • Determine memory cell generation and persistence

  • Formulation and Delivery Optimization:

    • Test different adjuvant systems

    • Evaluate administration routes

    • Assess dosing schedules

  • Safety Evaluation:

    • Local and systemic reactogenicity

    • Cross-reactivity with human proteins

    • Long-term follow-up for delayed adverse effects

Experimental design should include appropriate controls (adjuvant-only groups, irrelevant protein controls) and comprehensive immunological readouts. Statistical analysis requires adequate sample sizes determined by power analysis, with clearly defined primary and secondary endpoints. Research should systematically address both humoral and cellular immunity, as both may contribute to protection against T. pallidum infection .

What are the key knowledge gaps remaining in TP_0638 research?

Despite advances in Treponema pallidum research, significant knowledge gaps remain regarding TP_0638:

  • Structural Characterization:

    • Lack of experimentally determined 3D structure

    • Unknown binding sites and interaction interfaces

    • Limited information on post-translational modifications

  • Functional Role:

    • Undefined biological function in T. pallidum lifecycle

    • Unknown contribution to pathogenesis

    • Uncertain relationship with virulence mechanisms

  • Expression and Regulation:

    • Limited data on expression patterns during infection

    • Unknown regulatory mechanisms controlling expression

    • Unclear response to environmental conditions and stresses

  • Host Interaction:

    • Undefined interactions with host immune components

    • Unknown binding partners on host cells

    • Limited understanding of immunogenicity across infection stages

  • Genetic Variation:

    • Insufficient data on sequence conservation across strains

    • Unknown impact of genetic polymorphisms on function

    • Limited understanding of evolutionary pressures on TP_0638

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.