Recombinant Treponema pallidum Uncharacterized protein TP_0675 (TP_0675)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TP_0675; Uncharacterized protein TP_0675
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0675
Target Protein Sequence
MNTTGRPVFPLLRRTVLKRCSLCATRCAIVFLCVLLILPFLSCCTSLSRGALPSLISHKE RMFWEIRGPQGSVYILGTISVGSEKLLHFQDKILDVFDSASRLYAELGSEDIKNFASVLQ RRMLHGMLEQENAAPTLSSLSREELEMLRSTLGDDMHTLSRFEPWVMRVALYQALIAHTK LDSGKNIEAFLYQRAGNRKILGLDSIQKHLNMLSFGNREEQITLLRALIALGKSPADFKG RLGALVRSYLSNDKTALGRVSTELDALVTKDAAGGLHRRYVAEIAASRRAAWAEEFYRLS LQHGITFVFASAGHFCGPESVFDIMRKRRLLQ
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0675

STRING: 243276.TP0675

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Treponema pallidum Uncharacterized protein TP_0675?

TP_0675 is a full-length protein (332 amino acids) encoded by the TP_0675 gene in Treponema pallidum. It is currently classified as an uncharacterized protein with UniProt ID O83681. The protein has yet to be fully characterized in terms of its specific function within T. pallidum, though it is likely to contribute to the bacterium's unique biological properties . Unlike well-studied T. pallidum proteins such as Tp0965 or Tp0624, TP_0675 remains largely enigmatic in terms of its precise role in T. pallidum biology and pathogenesis.

T. pallidum is an obligate human pathogen that cannot be cultivated in vitro, which has significantly impeded progress in understanding its precise pathogenesis mechanisms. The availability of the T. pallidum genome sequence has made it possible to examine predicted open reading frames (ORFs), including TP_0675, for potential suitability as diagnostic or immunization tools .

How is recombinant TP_0675 typically produced for research applications?

Recombinant TP_0675 is typically produced using heterologous expression systems, most commonly in E. coli. The process involves several key steps:

  • Gene synthesis or cloning: The TP_0675 gene sequence is either synthesized based on the published T. pallidum genome or amplified from genomic DNA.

  • Vector construction: The gene is inserted into an expression vector containing appropriate regulatory elements and a His-tag sequence for purification purposes.

  • Transformation and expression: The recombinant vector is transformed into E. coli expression strains such as BL21(DE3).

  • Induction: Protein expression is induced using IPTG or other appropriate inducers.

  • Cell lysis and purification: Bacterial cells are harvested and lysed, and the His-tagged TP_0675 is purified using Ni-NTA affinity chromatography.

  • Quality control: The purified protein undergoes SDS-PAGE analysis to confirm purity (>90% is typically considered acceptable) .

  • Processing: The purified protein is formulated in appropriate buffer (typically Tris/PBS-based buffer with 6% Trehalose, pH 8.0) and lyophilized for storage .

This approach is similar to that used for other T. pallidum proteins, such as rTp0965, which has been successfully expressed and used for immunological studies .

What are the optimal storage and reconstitution conditions for recombinant TP_0675?

For optimal stability and activity, the following storage and reconstitution protocols are recommended:

  • Storage conditions:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration, with 50% being standard) for long-term storage

    • Aliquot and store at -20°C/-80°C

Storage ConditionDurationNotes
Lyophilized, -80°CLong-termPreferred for storage >6 months
Lyophilized, -20°CMedium-termSuitable for storage up to 6 months
Reconstituted, -80°C with 50% glycerolLong-termAliquot to avoid freeze-thaw cycles
Reconstituted, 4°CShort-termUse within one week

This storage paradigm is consistent with protocols for other recombinant T. pallidum proteins and helps maintain structural integrity and biological activity.

What experimental approaches are recommended for studying potential functions of TP_0675?

Due to the uncharacterized nature of TP_0675, multiple complementary approaches should be employed:

  • Bioinformatic analysis:

    • Sequence homology and domain prediction

    • Structural modeling and comparison

    • Genomic context analysis within the T. pallidum genome

  • Protein interaction studies:

    • Pull-down assays using His-tagged TP_0675

    • Yeast two-hybrid screens against T. pallidum protein libraries

    • Co-immunoprecipitation with suspected binding partners

  • Cellular assays (similar to those used for Tp0965):

    • Evaluate effects on host cell adhesion molecules (ICAM-1, E-selectin)

    • Assess impact on chemokine production (e.g., MCP-1)

    • Test for effects on endothelial permeability using transwell assays

  • Immunological characterization:

    • Assess reactivity with sera from syphilis patients at different disease stages

    • Evaluate immunogenicity in animal models

    • Characterize antibody responses to different epitopes

  • Localization studies:

    • Immunogold electron microscopy to determine subcellular localization

    • Membrane fractionation to determine association with specific cellular compartments

These approaches should be designed with appropriate controls, including other characterized T. pallidum proteins such as Tp0965 or Tp0624 .

How can researchers address the challenges of protein-protein interaction studies involving TP_0675?

Protein-protein interaction studies with TP_0675 present several unique challenges that require specific methodological adaptations:

  • Bait protein preparation:

    • Express TP_0675 with different fusion tags (His, GST, MBP) to optimize solubility

    • Consider using truncated constructs if the full-length protein presents solubility issues

    • Verify proper folding using circular dichroism or limited proteolysis

  • Pull-down assay optimization:

    • Use mild detergents (0.1% Triton X-100 or 0.5% NP-40) to reduce non-specific binding

    • Include appropriate negative controls (unrelated His-tagged proteins)

    • Perform stringent washing steps with increasing salt concentrations (150-500 mM NaCl)

  • Validation of interactions:

    • Confirm interactions using multiple techniques (pull-down, co-IP, SPR)

    • Perform reverse pull-downs with the identified interacting partners

    • Use deletion mutants to map interaction domains

  • Overcoming limitations of recombinant proteins:

    • Consider cell-free expression systems if E. coli-expressed protein is problematic

    • Use chemical crosslinking to capture transient interactions

    • Employ proximity labeling techniques such as BioID or APEX2

These methodological approaches account for the challenges of working with proteins from an uncultivable organism and help ensure reliable, reproducible results in protein interaction studies.

How might TP_0675 contribute to T. pallidum pathogenesis based on current understanding of T. pallidum proteins?

While the specific function of TP_0675 remains unknown, several hypotheses can be formulated based on our understanding of other T. pallidum proteins:

  • Potential role in host-pathogen interactions: Many T. pallidum surface proteins, such as Tp0965, are involved in adhesion to host cells and tissues. Tp0965 has been shown to activate endothelial cells and increase the expression of adhesion molecules like ICAM-1 and E-selectin . TP_0675 might play a similar role in modulating host cell responses.

  • Possible involvement in immune evasion: T. pallidum proteins often contribute to immune evasion mechanisms. TP_0675 might participate in these processes through interactions with host immune components.

  • Structural contributions to the unique T. pallidum cell envelope: T. pallidum has an unusual cell envelope ultrastructure that differentiates it from conventional Gram-negative bacteria. The peptidoglycan layer is chemically distinct, thinner, and more distal to the outer membrane . Like Tp0624, which has a divergent OmpA-like domain, TP_0675 might contribute to the structural integrity of this unique cell envelope.

  • Potential enzymatic activity: Based on sequence analysis, TP_0675 might possess enzymatic functions that contribute to T. pallidum metabolism or host tissue invasion.

To investigate these possibilities, researchers should consider comparative studies with other characterized T. pallidum proteins and employ functional assays that test these hypotheses directly.

What approaches should be used to investigate the immunological potential of TP_0675?

Investigating the immunological potential of TP_0675 requires a systematic approach:

  • Epitope mapping and analysis:

    • Use overlapping peptide arrays to identify immunodominant regions

    • Perform in silico prediction of B-cell and T-cell epitopes

    • Validate predicted epitopes using synthetic peptides and patient sera

  • Serological studies:

    • Test reactivity of recombinant TP_0675 with sera from syphilis patients at different stages

    • Compare reactivity patterns with those of established diagnostic antigens

    • Evaluate cross-reactivity with sera from patients with other treponematoses

  • Animal immunization studies:

    • Assess immunogenicity of recombinant TP_0675 in rabbit models

    • Evaluate protective capacity against challenge with virulent T. pallidum

    • Characterize antibody responses (isotype, avidity, neutralizing capacity)

  • Cellular immunity assessment:

    • Measure T-cell responses to TP_0675 in PBMCs from syphilis patients

    • Characterize cytokine profiles induced by TP_0675 stimulation

    • Evaluate memory B and T cell responses in previously infected individuals

Experimental ApproachKey MeasurementsExpected Outcomes
Epitope MappingReactivity with overlapping peptidesIdentification of immunodominant regions
Serological TestingIgG, IgM titers against TP_0675Assessment of diagnostic potential
Animal ImmunizationAntibody titers, protection from challengeEvaluation of vaccine potential
T-cell AssaysCytokine profiles, proliferationCharacterization of cellular immunity

Similar approaches have been used successfully with other T. pallidum proteins, such as Tp0965, which demonstrated strong immunogenicity and immunoreactivity in previous studies .

How does TP_0675 compare to other characterized T. pallidum proteins in terms of structure and potential function?

Comparative analysis between TP_0675 and better-characterized T. pallidum proteins provides valuable context:

  • Comparison with Tp0965: Tp0965 is a 35.4 kDa membrane fusion protein located in the periplasm of T. pallidum. It shows strong immunoreactivity with sera from syphilitic individuals at all stages and has demonstrated roles in endothelial cell activation and increasing endothelial permeability . TP_0675, at 332 amino acids, is slightly smaller than Tp0965 (320 amino acids), but both proteins may share similar immunogenic properties, though likely with distinct functions.

  • Comparison with Tp0624: Tp0624 has been structurally characterized and shows a multi-modular architecture comprised of three distinct domains, including a C-terminal divergent OmpA-like domain . Unlike conventional OmpA domains, the one in Tp0624 cannot bind diaminopimelic acid, suggesting a specialized function. TP_0675 lacks apparent homology to OmpA domains but might similarly have evolved specialized functions within the unique T. pallidum cell envelope.

  • Genomic context analysis: Unlike Tp0965, which is located within the tp34 gene cluster (the tp0959 to tp0972 genes) that may function as an operon , the genomic context of TP_0675 within the T. pallidum genome may provide additional clues about its potential functional associations.

Understanding these comparisons provides a framework for developing targeted hypotheses about TP_0675 function that can be experimentally tested.

What emerging technologies might advance our understanding of TP_0675 function?

Several cutting-edge technologies hold promise for elucidating TP_0675 function:

  • Cryo-electron microscopy (Cryo-EM): While X-ray crystallography has been used to determine the structure of Tp0624 , Cryo-EM offers advantages for proteins that are difficult to crystallize and can provide structural insights even for membrane-associated proteins.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can provide information about protein dynamics and ligand binding without requiring protein crystallization, potentially revealing functional domains within TP_0675.

  • In situ crosslinking and proximity labeling: Techniques such as BioID or APEX2 can identify proteins that interact with TP_0675 in a cellular context, overcoming limitations of traditional pull-down assays.

  • Single-molecule techniques: Methods such as single-molecule FRET can provide insights into protein conformational changes and interactions at the individual molecule level.

  • Systems biology approaches: Integration of proteomics, transcriptomics, and metabolomics data can place TP_0675 within the broader context of T. pallidum biology and pathogenesis.

  • Humanized mouse models: Recent advances in developing humanized mouse models for T. pallidum infection may provide platforms for studying TP_0675 function in vivo.

These technologies, combined with traditional biochemical and cellular approaches, represent the most promising avenues for advancing our understanding of this uncharacterized protein's role in T. pallidum biology and syphilis pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.