Recombinant Treponema pallidum Uncharacterized protein TP_0707 (TP_0707)

Shipped with Ice Packs
In Stock

Description

Overview of Treponema pallidum and TP_0707

Treponema pallidum is a spirochete bacterium that causes syphilis . This bacterium has the ability to adhere to mammalian cells and components of the extracellular matrix (ECM) . TP_0707 is a protein of Treponema pallidum, but its function remains uncharacterized.

Genetic Manipulation and Fluorescence Studies

Recent developments in the in vitro cultivation and genetic manipulation of syphilis spirochetes have facilitated the creation of fluorescent T. pallidum strains . One study generated an infectious T. pallidum strain that constitutively expresses green fluorescent protein (GFP), which was used to visualize the interaction of T. pallidum with host cells and to characterize antibodies against treponemal outer membrane proteins . These fluorescent T. pallidum strains offer a valuable tool for studying host-pathogen interactions, which enable the syphilis spirochete to establish infection and persist within its human host .

Opsonophagocytosis and Antibody-Mediated Clearance

Macrophage-mediated opsonophagocytosis of T. pallidum is considered critical for spirochete clearance . Studies have used antisera against TP0751, a lipoprotein, as a negative control in opsonophagocytosis assays . Preincubation of in vitro-cultivated GFP+ T. pallidum with mouse sera increased internalization by bone marrow-derived macrophages, demonstrating the role of antibodies in promoting phagocytosis .

Proteolytic Activity of TP0751

Research indicates that TP0751, another T. pallidum protein, exhibits zinc-dependent protease activity and can degrade human fibrinogen and laminin . This proteolytic activity was abolished by the metalloprotease inhibitor 1,10-phenanthroline, and inductively coupled plasma-mass spectrometry showed that TP0751 binds zinc and calcium . Site-directed mutagenesis studies are required to identify the critical active site residues associated with this protein .

Diagnostic Molecular Techniques

Diagnostic molecular techniques such as quantitative polymerase chain reaction (qPCR) and transcription-mediated amplification (TMA) are used for the detection of Treponema pallidum in maternal and neonatal specimens . These techniques aid in the diagnosis of syphilis using the Centers for Disease Control’s (CDC’s) Sexually Transmitted Infections (STI) Treatment Guidelines .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request but will incur additional charges. Please contact us in advance to arrange this.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
TP_0707; Uncharacterized protein TP_0707
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0707
Target Protein Sequence
MRGTPAYHAVSGVPCSACTCTQVAVQLALSWRGSMGRLKRCEVRRRPCALWAIVRVARIG ALAAMLAVLSFALGCALVYPLWALAVHRPRVFSVLSGLLYGGGAVLWGLRRVCNALSYAR VRRAGRRAAAQEPCVLVQAGEVGAMGLSSSAEVRPAQEC
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0707

STRING: 243276.TP0707

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TP_0707 and why is it significant in T. pallidum research?

TP_0707 (UniProt ID: O83705) is an uncharacterized protein from Treponema pallidum, the bacterium responsible for syphilis infection. This 159-amino acid protein remains functionally uncharacterized but has gained research significance for several reasons. First, as part of the comprehensive T. pallidum proteome, it represents one of the proteins that could contribute to our understanding of the pathogen's biology and virulence mechanisms . Second, recombinant TP_0707 provides researchers with a tool to study specific aspects of T. pallidum without requiring cultivation of the notoriously difficult-to-culture spirochete in laboratory settings .

The protein's significance lies in its potential as a research target for:

  • Understanding T. pallidum protein function

  • Developing diagnostic tools for syphilis

  • Exploring potential vaccine candidates

  • Studying host-pathogen interactions

Methodologically, researchers typically approach uncharacterized proteins like TP_0707 through comparative sequence analysis, structural predictions, recombinant expression, and functional assays to gradually build understanding of their biological roles.

How does TP_0707 compare to other T. pallidum proteins in immunological studies?

While specific immunological data for TP_0707 is limited in the provided search results, we can draw comparisons with other T. pallidum proteins that have been extensively studied. Comprehensive proteome studies of T. pallidum have identified numerous immunogenic proteins that elicit strong antibody responses during infection .

ParameterTP_0707Well-characterized T. pallidum proteins (e.g., TpN47, TmpA)
Antibody response timingNot fully determinedMany reach 100% seroprevalence by day 20-30 post-infection
IgG binding normalized valuesData not availableRange from approximately 3.0-7.0 (varies by strain)
LocalizationPredicted membrane-associatedMany are lipoproteins or membrane proteins
FunctionUncharacterizedVarious (adhesins, transporters, structural proteins)

When designing immunological studies with TP_0707, researchers should consider:

  • Comparing antibody responses to those of well-characterized proteins like TpN47 (Tp0574) and TmpA (Tp0768)

  • Evaluating seroprevalence across different infection time points

  • Testing both IgG and IgM responses

  • Including proper positive and negative controls

The comprehensive immunological profiling approach used for known T. pallidum antigens provides a methodological framework for characterizing TP_0707 .

What are the optimal conditions for expressing recombinant TP_0707?

Based on established protocols for TP_0707 and similar T. pallidum proteins, the following methodological approach is recommended for optimal expression:

  • Expression System: E. coli is the preferred host for recombinant TP_0707 expression . BL21(DE3) or Rosetta strains are commonly used for proteins with rare codons.

  • Vector Selection: pET-based vectors with N-terminal His-tags facilitate expression and subsequent purification . The His-tag placement should be optimized if it interferes with protein folding.

  • Expression Conditions:

    • Temperature: 16-18°C for overnight expression often yields better soluble protein than standard 37°C incubation

    • IPTG concentration: 0.1-0.5 mM typically provides sufficient induction while minimizing inclusion body formation

    • Media: Enriched media (e.g., TB or 2xYT) rather than standard LB often increases yield

    • Additives: 0.1% glucose to prevent leaky expression; 1-5% ethanol or 4°C cold-shock to improve folding

  • Optimization Parameters:

    • Expression should be monitored at multiple time points (4, 8, 16, 24 hours)

    • Soluble vs. insoluble fraction distribution should be analyzed by SDS-PAGE

    • Cell density at induction time should be optimized (typically OD600 of 0.6-0.8)

If expression yields remain low, alternative approaches include:

  • Using solubility-enhancing fusion partners (SUMO, MBP, TrxA)

  • Testing multiple E. coli strains (Arctic Express for cold-adapted chaperones)

  • Implementing auto-induction media for gradual induction

What purification methods yield the highest purity for TP_0707?

A multi-step purification strategy is recommended for obtaining high-purity TP_0707:

  • Initial Capture: Immobilized Metal Affinity Chromatography (IMAC)

    • Ni-NTA resin is most common for His-tagged TP_0707

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-20 mM imidazole

    • Washing steps: 20-40 mM imidazole to remove non-specific binding

    • Elution: 250-300 mM imidazole gradient

    • Add 1 mM PMSF and protease inhibitor cocktail to prevent degradation

  • Intermediate Purification: Ion Exchange Chromatography

    • Based on the predicted pI of TP_0707, select appropriate resin (typically Q Sepharose for anion exchange)

    • Start with low salt buffer and elute with salt gradient to 1 M NaCl

  • Polishing Step: Size Exclusion Chromatography

    • Superdex 75 or 200 column depending on oligomerization state

    • Buffer: PBS or 20 mM Tris-HCl pH 7.5, 150 mM NaCl

    • Analyze fractions using SDS-PAGE

  • Quality Control:

    • Purity assessment: SDS-PAGE (should exceed 90%)

    • Identity confirmation: Western blot using anti-His antibodies

    • Structural integrity: Circular dichroism or limited proteolysis

For long-term storage, lyophilization with 6% trehalose in Tris/PBS buffer (pH 8.0) is recommended to maintain stability . Aliquot and store at -80°C to avoid freeze-thaw cycles.

How can researchers verify the functional integrity of purified TP_0707?

Since TP_0707 is uncharacterized, verifying functional integrity presents unique challenges. The following methodological approaches are recommended:

  • Structural Integrity Assessment:

    • Circular Dichroism (CD) spectroscopy to confirm secondary structure elements

    • Thermal shift assays to determine protein stability and proper folding

    • Dynamic Light Scattering (DLS) to verify monodispersity and absence of aggregation

    • Limited proteolysis to confirm compact, folded structure

  • Binding Assays:

    • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI) to test for interactions with potential binding partners

    • Potential binding partners may include human serum components, extracellular matrix proteins, or other bacterial proteins

  • Functional Prediction Validation:

    • If bioinformatic analysis predicts enzymatic activity, design specific activity assays

    • For predicted membrane proteins, liposome association assays

    • For predicted DNA/RNA binding proteins, electrophoretic mobility shift assays (EMSA)

  • Immunological Function:

    • ELISA using sera from syphilis patients to test for antibody recognition

    • T-cell stimulation assays to assess immunogenicity

How should I analyze proteomic data involving TP_0707?

When analyzing proteomic data for TP_0707, researchers should apply the following methodological framework:

  • Mass Spectrometry Data Analysis:

    • Search MS data against T. pallidum proteome databases

    • Use multiple search engines (e.g., Mascot, SEQUEST, X!Tandem) to increase confidence

    • Apply appropriate false discovery rate (FDR) cutoffs (typically 1%)

    • Validate peptide identifications manually for critical peptides

  • Quantitative Analysis:

    • For label-free quantification, normalize to total protein abundance or stable reference proteins

    • For isotope labeling approaches (SILAC, TMT, iTRAQ), verify labeling efficiency

    • Apply appropriate statistical tests (t-test for simple comparisons, ANOVA for multiple conditions)

    • Consider both fold-change and statistical significance (volcano plots)

  • Comparative Analysis:

    • Compare TP_0707 expression/abundance across different conditions (e.g., growth phases, stress conditions)

    • Cluster analysis to identify proteins with similar expression patterns

    • Network analysis to identify potential interaction partners

  • Data Visualization:

    • Present data in clear tabular format following best practices

    • Use column headers that clearly describe the nature of the data

    • Avoid presenting identical information in both tables and graphs

    • Design tables to be understandable without reference to the text

Sample table format for presenting TP_0707 proteomic data:

ConditionTP_0707 Spectral CountsTP_0707 Normalized AbundanceStatistical Significance (p-value)Co-expressed Proteins
Early infectionDataDataDataData
Late infectionDataDataDataData
In vitro cultureDataDataDataData

What bioinformatic approaches are useful for predicting TP_0707 function?

For uncharacterized proteins like TP_0707, a comprehensive bioinformatic analysis workflow should include:

  • Sequence-Based Analysis:

    • PSI-BLAST for distant homology detection

    • Multiple sequence alignment (MUSCLE, CLUSTAL) with homologous proteins

    • Conserved domain analysis (CDD, PFAM, InterPro)

    • Secondary structure prediction (PSIPRED, JPred)

    • Transmembrane domain prediction (TMHMM, Phobius)

    • Signal peptide prediction (SignalP)

    • Post-translational modification sites prediction

  • Structural Analysis:

    • 3D structure prediction (AlphaFold2, I-TASSER, Rosetta)

    • Molecular dynamics simulations to identify stable conformations

    • Structure-based function prediction (ProFunc, COACH)

    • Binding site prediction (CASTp, FTSite)

  • Genomic Context Analysis:

    • Operon prediction and co-expression analysis

    • Phylogenetic profiling to identify co-evolving genes

    • Synteny analysis across related bacterial species

  • Network-Based Approaches:

    • Protein-protein interaction prediction (STRING)

    • Gene ontology enrichment analysis of predicted interactors

    • Pathway analysis to place TP_0707 in biological context

  • Integration of Multiple Lines of Evidence:

    • Weighted scoring systems for function prediction

    • Machine learning approaches trained on known bacterial proteins

    • Critical assessment of contradictory predictions

Researchers should note that bioinformatic predictions require experimental validation, and confidence increases when multiple methods converge on similar functional predictions.

How should conflicting experimental results regarding TP_0707 be interpreted?

When faced with contradictory experimental data about TP_0707, follow this methodological framework:

  • Systematically Evaluate Experimental Conditions:

    • Compare protein preparation methods (expression systems, purification protocols)

    • Assess buffer compositions and experimental temperatures

    • Evaluate protein concentrations and storage conditions

    • Consider tag positions and their potential influence

  • Assess Methodology Differences:

    • Different detection methods may have varying sensitivities

    • Some techniques may detect only specific conformations

    • In vivo vs. in vitro studies may yield different results due to cellular context

  • Statistical Robustness Analysis:

    • Evaluate sample sizes and statistical power

    • Check for appropriate controls and replicates

    • Consider p-value adjustments for multiple testing

  • Reconciliation Strategies:

    • Develop hypotheses that account for apparently contradictory results

    • Design critical experiments to specifically address discrepancies

    • Consider that TP_0707 may have multiple functions or conformations

    • Evaluate whether post-translational modifications explain differences

  • Collaborative Approach:

    • Engage with other research groups for independent verification

    • Consider standardization of protocols across laboratories

    • Pool data from multiple studies for meta-analysis when appropriate

When presenting conflicting data in publications, transparent reporting of all methodological details is essential. Tables comparing different experimental conditions and their outcomes should be included to help readers understand potential sources of variation .

How can TP_0707 be used in developing diagnostic assays for syphilis?

Developing TP_0707-based diagnostic assays requires a methodical approach:

  • Assessing Diagnostic Potential:

    • Evaluate antibody responses to TP_0707 in syphilis patients vs. controls

    • Determine sensitivity, specificity, and cross-reactivity

    • Compare performance against established T. pallidum antigens like TpN47 and TmpA

    • Create ROC curves to optimize cutoff values

  • ELISA Development Methodology:

    • Optimize coating conditions (concentration, buffer, pH)

    • Determine optimal blocking agents to reduce background

    • Establish appropriate sample dilutions and incubation times

    • Select detection antibodies with minimal cross-reactivity

    • Include calibration curves using reference standards

  • Multiplex Assay Development:

    • Combine TP_0707 with other T. pallidum antigens for improved sensitivity

    • Address potential antigenic competition effects

    • Validate individual and combined performance metrics

    • Optimize signal-to-noise ratios for each antigen

  • Lateral Flow Assay Considerations:

    • Evaluate protein stability on various membrane types

    • Optimize gold nanoparticle conjugation conditions

    • Determine flow rates and sample volume requirements

    • Assess shelf-life under various storage conditions

Expected performance metrics can be presented in a comparative table:

Diagnostic ParameterTP_0707 AloneTP_0707 + TpN47Commercial Test
Sensitivity (%)DataDataData
Specificity (%)DataDataData
PPV (%)DataDataData
NPV (%)DataDataData
Time to seroconversion (days)DataDataData

Researchers should particularly focus on whether TP_0707 might detect antibodies at different disease stages compared to current diagnostic antigens, potentially offering improved early detection or monitoring of treatment response.

What role might TP_0707 play in T. pallidum pathogenesis?

Investigating TP_0707's potential role in pathogenesis requires a multi-faceted experimental approach:

  • Expression Analysis During Infection:

    • Quantify TP_0707 expression levels at different stages of infection

    • Compare expression in different tissues using immunohistochemistry

    • Assess expression under various environmental conditions (pH, temperature, oxygen)

    • Determine whether expression changes in response to host factors

  • Host Interaction Studies:

    • Identify potential host receptors or binding partners using pull-down assays

    • Perform cell adhesion assays with recombinant TP_0707

    • Assess impact on host cell signaling pathways

    • Evaluate effects on immune cell function (phagocytosis, cytokine production)

  • Animal Model Studies:

    • Develop antibodies against TP_0707 for passive immunization studies

    • Assess whether anti-TP_0707 antibodies modify disease progression

    • Consider ethical constraints similar to those that emerged from historical studies

  • Comparative Analysis:

    • Compare sequence and function with homologs in non-pathogenic treponemes

    • Assess conservation across T. pallidum strains with different virulence

    • Identify structural motifs shared with virulence factors in other bacteria

When designing pathogenesis studies, researchers must consider the ethical implications of their research, particularly given the historical context of unethical experimentation with T. pallidum . Modern research must adhere to strict ethical guidelines while advancing understanding of syphilis pathogenesis.

How can protein-protein interaction studies with TP_0707 be designed?

For studying TP_0707 interactions, consider this comprehensive methodological approach:

  • In Vitro Interaction Assays:

    • Pull-down assays using His-tagged TP_0707 as bait

    • Surface Plasmon Resonance (SPR) for kinetic and affinity measurements

    • Microscale Thermophoresis (MST) for interactions in solution

    • AlphaScreen for high-throughput screening of potential interactors

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use MS-cleavable crosslinkers for improved identification

    • Optimize crosslinker concentration and reaction times

    • Process samples following established proteomic workflows

    • Analyze data with specialized XL-MS software (e.g., xQuest, pLink)

  • Yeast Two-Hybrid (Y2H) Screening:

    • Generate TP_0707 bait constructs in different configurations

    • Screen against T. pallidum prey library and human cDNA libraries

    • Validate positive interactions with orthogonal methods

    • Consider split-ubiquitin Y2H for membrane-associated interactions

  • Co-immunoprecipitation from Native Context:

    • Develop specific antibodies against TP_0707

    • Extract protein complexes under mild conditions

    • Identify interacting partners by mass spectrometry

    • Validate with reciprocal co-IP experiments

  • Biophysical Characterization of Complexes:

    • Size Exclusion Chromatography - Multi-Angle Light Scattering (SEC-MALS)

    • Analytical Ultracentrifugation (AUC)

    • Native Mass Spectrometry

    • Cryo-Electron Microscopy for structural characterization

Data analysis should incorporate:

  • Filtering of common contaminants and non-specific interactors

  • Network visualization of interaction partners

  • Functional enrichment analysis of interacting proteins

  • Structural modeling of interaction interfaces

Researchers should be aware that interactions observed in vitro may not reflect the native context, necessitating validation in more physiologically relevant systems when possible.

Why might recombinant TP_0707 expression yields be low?

Low expression yields of recombinant TP_0707 can result from multiple factors. Apply this systematic troubleshooting methodology:

  • Codon Usage Issues:

    • T. pallidum has different codon bias than E. coli

    • Solution: Use codon-optimized gene synthesis or Rosetta strains containing rare tRNAs

    • Analyze Codon Adaptation Index (CAI) of your construct

  • Protein Toxicity:

    • TP_0707 may be toxic to E. coli when overexpressed

    • Solution: Use tightly controlled expression systems (pET with T7 lysozyme)

    • Lower induction temperature (16°C) and IPTG concentration (0.1 mM)

    • Consider auto-induction media for gradual expression

  • Protein Instability/Degradation:

    • Solution: Add protease inhibitors during extraction

    • Use E. coli strains lacking specific proteases (BL21)

    • Reduce expression time and harvest before degradation occurs

    • Check for degradation bands on Western blots

  • Improper Protein Folding:

    • Solution: Co-express with chaperones (GroEL/ES, DnaK/J)

    • Add folding enhancers to media (1% glucose, 500 mM sorbitol, 3 mM betaine)

    • Express as fusion with solubility-enhancing tags (SUMO, MBP)

  • Extraction Issues:

    • Solution: Optimize lysis conditions (sonication parameters, detergents)

    • Try different buffer compositions and pH values

    • For membrane-associated proteins, include mild detergents (0.1% DDM, CHAPS)

Implement a systematic optimization strategy by testing multiple variables simultaneously using a factorial design approach. Document all conditions in a structured table format for clear analysis of results .

How can protein aggregation issues with TP_0707 be addressed?

Protein aggregation is a common challenge with recombinant proteins. Apply these methodological solutions:

  • During Expression:

    • Reduce expression temperature to 16-18°C

    • Decrease inducer concentration

    • Co-express with molecular chaperones

    • Use strains designed for membrane proteins (C41/C43)

    • Add chemical chaperones to media (glycerol, arginine, proline)

  • During Purification:

    • Include mild detergents (0.05% DDM, 0.1% CHAPS)

    • Add stabilizing agents (5-10% glycerol, 50-100 mM arginine)

    • Maintain moderate salt concentration (200-300 mM NaCl)

    • Avoid extreme pH conditions

    • Include reducing agents if cysteines are present (1-5 mM DTT or TCEP)

  • Buffer Optimization Matrix:

    • Test multiple buffers (HEPES, Tris, Phosphate) at different pH values

    • Evaluate various additives systematically

    • Use differential scanning fluorimetry to assess thermal stability

    • Apply dynamic light scattering to monitor aggregation state

  • Refolding Strategies (if inclusion bodies are unavoidable):

    • Solubilize in 8M urea or 6M guanidine-HCl

    • Gradually remove denaturant by dialysis or dilution

    • Use pulse refolding with chaperone systems

    • Try on-column refolding during purification

  • Storage Conditions:

    • Lyophilize with stabilizing agents (6% trehalose)

    • Store at high concentration to prevent surface adsorption

    • Avoid freeze-thaw cycles by preparing single-use aliquots

    • Test stability at 4°C vs. -20°C vs. -80°C

Comprehensive stability screening should be performed systematically and results documented in a structured table format, comparing multiple conditions simultaneously .

What strategies can enhance antibody recognition of TP_0707 in immunoassays?

When antibody recognition of TP_0707 is suboptimal, implement these methodological improvements:

  • Antigen Preparation Optimization:

    • Ensure protein is properly folded by verifying with biophysical methods

    • Try both native and denatured conditions for coating

    • Use directional immobilization (via His-tag) to expose relevant epitopes

    • Consider removing tags if they interfere with epitope accessibility

    • Evaluate different coating buffers and pH conditions

  • Antibody Development Strategies:

    • Use multiple peptide antigens from different regions of TP_0707

    • Try genetic immunization with DNA encoding TP_0707

    • Implement prime-boost strategies with different antigen forms

    • Screen antibodies against both linear and conformational epitopes

    • Develop monoclonal antibodies for increased specificity

  • Assay Condition Optimization:

    • Test various blocking agents (BSA, milk, commercial blockers)

    • Optimize antibody concentration and incubation time

    • Evaluate different detection systems (direct vs. indirect)

    • Add stabilizing proteins (0.1-0.5% BSA) to all buffers

    • Include mild detergents (0.05% Tween-20) to reduce non-specific binding

  • Assay Sensitivity Enhancement:

    • Implement signal amplification (e.g., tyramine signal amplification)

    • Use high-sensitivity substrates (chemiluminescent or fluorescent)

    • Try sandwich ELISA format if multiple epitopes are available

    • Consider alternative detection platforms (Luminex, ELISA-on-a-chip)

Document optimization results in a structured comparison table to identify optimal conditions. Remember that assay performance should be validated with appropriate positive and negative controls to ensure specificity for TP_0707 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.