Recombinant Treponema pallidum Uncharacterized protein TP_0708 (TP_0708)

Shipped with Ice Packs
In Stock

Description

Introduction

Treponema pallidum is a spirochete bacterium that causes syphilis, a sexually transmitted infection characterized by tissue dissemination and chronic infection . The bacterium's ability to evade the host's immune system contributes to its persistence . Research on T. pallidum focuses on identifying its proteins and understanding their roles in pathogenesis, with the aim of developing effective diagnostic markers and potential vaccine candidates . Among the many proteins of T. pallidum is an uncharacterized protein, TP_0708.

Characteristics of TP_0708

Currently, TP_0708's specific characteristics remain largely uncharacterized. Studies suggest that several T. pallidum antigens, including hypothetical proteins, react specifically with infected human serum . Further research is needed to elucidate the precise functions and interactions of TP_0708 within the T. pallidum bacterium.

Role in Pathogenesis and Immunity

T. pallidum expresses numerous lipoproteins, with some, like TP0751, acting as vascular adhesins that interact with endothelial cells and influence the expression of tight junction proteins, thus enabling the bacterium to breach the blood-brain barrier . Other lipoproteins, such as TP0136 and TP0435, also play roles in adhesion, immune activation, and inflammatory processes .

Diagnostic and Vaccine Potential

Several T. pallidum proteins have diagnostic value and serve as potential vaccine candidates . For example, TP0435 is commonly used in syphilis diagnosis . Further research into TP_0708 and other uncharacterized proteins could reveal novel targets for diagnostic assays or vaccine development.

Research and Findings

Proteomic and serologic analyses of T. pallidum have identified numerous antigens, including hypothetical proteins, that react with sera from infected humans . These findings offer insights into host-pathogen interactions and may help identify potential vaccine candidates or diagnostic markers .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TP_0708; Uncharacterized protein TP_0708
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0708
Target Protein Sequence
MDVQERRFSCAAVGASLKVPAIAAGAAFFLSIATAAVARNARVYVSVARATVLALGAGVT AYALRALLAYVVPDLLVQEDGKMPIPHVDLTLDDVVEPSFASPGGDVVQETDDSFDSLIP TGELGELGYSFSPSTPSFEDKTSDLVGDVLTDLPETKRMARAIRTVLSQDT
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0708

STRING: 243276.TP0708

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of T. pallidum uncharacterized protein TP_0708?

While TP_0708 remains uncharacterized, researchers can predict potential functions through comparative analysis with other T. pallidum proteins. Similar to proteins like Tp0624, TP_0708 may be involved in cell envelope biogenesis or maintenance. The approach to determining function involves bioinformatic analysis of sequence homology, protein domain prediction, and structural modeling. Homology modeling can provide initial insights into potential functional domains, which should then be validated through experimental approaches including recombinant protein expression and functional assays . Researchers should analyze the protein sequence for conserved domains, cellular localization signals, and structural motifs that might indicate membrane association or enzymatic activity.

How can I express recombinant TP_0708 protein for experimental studies?

Expression of recombinant T. pallidum proteins requires optimization of several parameters. Based on approaches used for other T. pallidum proteins, researchers should consider a systematic expression protocol:

  • Clone the TP_0708 gene into an appropriate expression vector with a fusion tag (His-tag, GST, or MBP) to facilitate purification

  • Transform into E. coli expression strains (BL21, Rosetta, or SHuffle) depending on predicted protein characteristics

  • Test multiple expression conditions including temperature (16°C, 25°C, 37°C), IPTG concentration (0.1-1.0 mM), and expression duration (4-24 hours)

  • Analyze protein solubility in different buffer systems

  • Optimize purification using affinity chromatography followed by size exclusion chromatography

For membrane-associated proteins like those in T. pallidum, inclusion of mild detergents in the purification buffers may be necessary to maintain protein solubility. Additionally, researchers should verify protein identity and purity using SDS-PAGE, Western blotting, and mass spectrometry before proceeding with functional studies .

What are the predicted structural characteristics of TP_0708?

While the specific structure of TP_0708 has not been characterized, researchers can apply structural prediction approaches similar to those used for other T. pallidum proteins. TP_0708 may share architectural features with proteins like Tp0624, which displays a multi-modular structure with distinct domains. Prediction tools can provide insights into secondary structure elements (alpha helices, beta sheets), potential transmembrane regions, and conserved structural motifs.

For crystallographic studies, researchers should consider:

  • Screening multiple constructs with varying N- and C-terminal boundaries to identify stable domains

  • Testing various buffer conditions and additives for crystal formation

  • Employing both X-ray crystallography and NMR approaches depending on protein size and stability

  • Using molecular dynamics simulations to complement experimental structural data

Researchers should be aware that T. pallidum proteins often have unique structural features that differentiate them from conventional bacterial proteins, potentially reflecting adaptations to the organism's parasitic lifestyle and unusual cell envelope architecture .

How should I design experiments to characterize the function of TP_0708?

Designing experiments to characterize an uncharacterized protein requires a systematic approach. Based on methodologies applied to other T. pallidum proteins, researchers should consider the following experimental design framework:

Research QuestionIndependent VariableDependent VariablePotential Controls
Does TP_0708 interact with host cells?Concentration of recombinant TP_0708Cell binding, cytokine production, or cell signaling activationHeat-inactivated protein, unrelated T. pallidum protein
Does TP_0708 have enzymatic activity?Substrate concentration and reaction conditionsEnzymatic activity measurements (spectroscopic readouts)No-enzyme control, inactive mutant
Is TP_0708 immunogenic?Exposure of immune cells to TP_0708Antibody production, T-cell responsesControl antigens, adjuvant-only controls
Does TP_0708 interact with other bacterial proteins?Presence/absence of potential binding partnersProtein-protein interactions (pull-down assays)Non-specific binding proteins, tag-only controls

What are the best approaches for studying potential immunomodulatory effects of TP_0708?

Based on studies of other T. pallidum proteins like Tp0768, researchers investigating potential immunomodulatory effects of TP_0708 should employ a multi-faceted approach:

  • Macrophage stimulation assays: Expose different macrophage subtypes to purified recombinant TP_0708 at varying concentrations and time points, then measure proinflammatory cytokine expression (IL-1β, IL-6, IL-8) using ELISA, qRT-PCR, and multiplex cytokine arrays

  • Signaling pathway analysis: Investigate activation of key inflammatory pathways (NF-κB, MAPK, ER stress) using Western blotting, reporter assays, and specific pathway inhibitors

  • ROS measurement: Quantify reactive oxygen species production using fluorescent probes like DCFDA

  • Pathway inhibition studies: Pre-treat cells with specific inhibitors (e.g., PERK inhibitors, ROS scavengers, NF-κB inhibitors) before TP_0708 exposure to determine pathway dependencies

  • Mechanistic validation: Use gene knockdown/knockout approaches to confirm specific pathway components

When designing these experiments, researchers should include dose-response and time-course analyses to establish temporal relationships between protein exposure and cellular responses. Importantly, endotoxin contamination must be rigorously controlled, as it can confound results in immunological assays. Using polymyxin B or endotoxin removal columns during protein purification, along with including proteinase K-treated controls, can help distinguish protein-specific effects from endotoxin contamination .

How can I determine if TP_0708 is expressed during different stages of T. pallidum infection?

Determining stage-specific expression of T. pallidum proteins requires multiple complementary approaches:

  • Transcriptional analysis: Design specific primers for TP_0708 and perform qRT-PCR on RNA extracted from T. pallidum at different infection stages. Compare expression levels to housekeeping genes to establish relative expression patterns.

  • Proteomic analysis: Use mass spectrometry-based approaches to detect TP_0708 in samples from different infection stages. Both shotgun proteomics and targeted approaches like selected reaction monitoring (SRM) can be employed.

  • Immunological detection: Develop specific antibodies against recombinant TP_0708 for immunohistochemistry or Western blot detection in infected tissues.

  • Patient serum analysis: Test for antibodies against TP_0708 in patient sera from different syphilis stages to determine if an antibody response develops, suggesting in vivo expression.

Researchers should be aware of the technical challenges associated with T. pallidum studies, including the inability to continuously culture the organism in vitro. This necessitates the use of animal models (typically rabbit) for obtaining organisms at different infection stages. Additionally, careful sample preparation and sensitive detection methods are essential due to the relatively low abundance of many T. pallidum proteins .

What crystallization techniques are most suitable for determining the structure of TP_0708?

Crystallizing T. pallidum proteins presents unique challenges due to their often specialized structural features. Based on successful approaches with other treponemal proteins like Tp0624, researchers should consider the following crystallization strategy:

  • Protein construct optimization:

    • Design multiple constructs with different domain boundaries

    • Remove potential disordered regions that could hinder crystallization

    • Consider fusion proteins that may enhance solubility and crystallization propensity

  • Crystallization screening:

    • Employ high-throughput initial screening with commercial sparse matrix screens

    • Test a wide range of precipitants, buffers, and additives

    • Include ligands or binding partners that might stabilize the protein

  • Optimization approaches:

    • Fine-tune promising crystallization conditions by varying precipitant concentration, pH, and temperature

    • Implement seeding techniques to improve crystal quality

    • Consider crystallization in lipidic environments for membrane-associated domains

  • Data collection and processing:

    • Collect high-resolution diffraction data (aiming for resolution better than 2.0 Å)

    • Process data carefully to account for potential twinning or other crystallographic artifacts

    • Consider phase determination strategies (molecular replacement or experimental phasing)

If crystallization proves challenging, researchers should consider alternative structural biology approaches such as cryo-electron microscopy for larger assemblies or NMR spectroscopy for smaller domains. As demonstrated with Tp0624, achieving a high-resolution structure (1.70 Å) is feasible with optimized conditions and careful crystal handling .

How can I determine if TP_0708 has a modular architecture similar to other T. pallidum proteins?

Determining the modular architecture of TP_0708 requires a combination of bioinformatic prediction and experimental validation:

Researchers studying T. pallidum proteins should note that, as demonstrated with Tp0624, these proteins often contain unique domain arrangements not found in other bacterial species. The identification of novel domain combinations may provide insights into the specialized functions of these proteins in T. pallidum pathogenesis .

How does TP_0708 potentially contribute to T. pallidum pathogenesis?

Understanding the role of TP_0708 in pathogenesis requires integrating findings from multiple experimental approaches and contextualizing them within the broader understanding of T. pallidum infection:

  • Host-pathogen interaction studies:

    • Assess the ability of TP_0708 to bind host cells or extracellular matrix components

    • Determine if TP_0708 affects host cell signaling pathways like those observed with Tp0768

    • Investigate potential effects on immune cell function and inflammatory responses

  • Immune evasion potential:

    • Evaluate whether TP_0708 interferes with complement activation or antibody binding

    • Assess effects on phagocytosis or intracellular killing mechanisms

    • Determine if TP_0708 modulates antigen presentation or adaptive immune responses

  • Bacterial physiology contributions:

    • Investigate potential roles in the unique T. pallidum cell envelope structure

    • Assess contributions to bacterial adhesion, invasion, or dissemination

    • Determine if TP_0708 is involved in nutrient acquisition or stress responses

  • Animal model studies:

    • Compare infection dynamics between wild-type T. pallidum and strains with modified TP_0708 expression

    • Assess tissue distribution, bacterial load, and inflammatory responses

    • Evaluate disease progression and manifestations

If TP_0708 shares functional characteristics with proteins like Tp0768, it may promote inflammatory responses through activation of ER stress and the ROS/NF-κB pathway in host cells. This could contribute to the tissue damage and clinical manifestations characteristic of syphilis infection. Alternatively, if TP_0708 resembles structural proteins like Tp0624, it might play roles in maintaining the distinctive T. pallidum cell envelope architecture, which is crucial for immune evasion and persistence in the host .

What cell signaling pathways might be affected by TP_0708 based on studies of related T. pallidum proteins?

Based on studies of Tp0768 and other T. pallidum proteins, TP_0708 might interact with several key cellular signaling pathways:

Signaling PathwayPotential Effects of TP_0708Experimental Approaches to Detect Activation
ER Stress ResponseActivation of PERK, IRE1α, or ATF6 branches leading to UPRWestern blot for phospho-PERK, phospho-IRE1α, XBP1 splicing assay, CHOP expression
ROS/NF-κB PathwayProduction of reactive oxygen species and NF-κB nuclear translocationDCFDA fluorescence for ROS, NF-κB nuclear translocation assay, IκB degradation assessment
MAPK CascadesActivation of p38, ERK, or JNK pathwaysPhospho-specific antibodies for pathway components, kinase activity assays
Inflammasome ActivationNLRP3 inflammasome assembly and IL-1β processingCaspase-1 activity, pro-IL-1β processing, ASC speck formation
TLR SignalingEngagement of pattern recognition receptorsMyD88 recruitment assays, TLR reporter cell lines, inhibition with specific antagonists

To establish causality between TP_0708 exposure and pathway activation, researchers should:

  • Perform time-course experiments to establish the sequence of signaling events

  • Use specific pathway inhibitors to demonstrate dependency relationships

  • Employ gene silencing or CRISPR knockout approaches to confirm key pathway components

  • Compare effects between purified TP_0708 and whole bacteria

Understanding the signaling pathways affected by TP_0708 could provide insights into how this protein might contribute to the inflammatory responses observed in syphilis and potentially identify targets for therapeutic intervention. As demonstrated with Tp0768, T. pallidum proteins can induce complex signaling cascades involving cross-talk between multiple pathways, such as the link between ER stress and ROS/NF-κB activation .

How might post-translational modifications affect the function of recombinant TP_0708?

Post-translational modifications (PTMs) can significantly impact protein function, and this consideration is particularly important when working with recombinantly expressed T. pallidum proteins:

  • Lipidation:

    • Many T. pallidum proteins, including numerous lipoproteins, undergo lipid modification

    • Expression systems may not correctly process these modifications

    • Researchers should analyze the TP_0708 sequence for lipobox motifs and consider the use of expression systems capable of lipid modification

    • Compare properties of lipidated vs. non-lipidated forms of the protein

  • Glycosylation:

    • While bacterial glycosylation differs from eukaryotic patterns, it may still occur

    • Mass spectrometry can detect potential glycosylation sites

    • Consider testing expression in different host systems that may provide varying glycosylation patterns

  • Phosphorylation:

    • Bacterial protein phosphorylation can regulate activity and interactions

    • Phosphoproteomic analysis can identify potential phosphorylation sites

    • Site-directed mutagenesis of predicted phosphorylation sites can assess functional significance

  • Disulfide bond formation:

    • Correct disulfide bond formation is critical for proper folding of many proteins

    • Analysis of cysteine residues and their conservation can predict potential disulfide bonds

    • Consider expression in systems that support disulfide bond formation (e.g., E. coli SHuffle strains)

When studying recombinant TP_0708, researchers should carefully compare the properties of the recombinant protein with those of the native protein whenever possible. Functional differences may indicate missing or incorrect PTMs. Additionally, researchers can employ mass spectrometry-based approaches to comprehensively characterize PTMs on both recombinant and native forms of the protein .

How can TP_0708 be evaluated as a potential diagnostic biomarker for syphilis?

Evaluating TP_0708 as a potential diagnostic biomarker requires a systematic approach similar to that used for other T. pallidum antigens like Tp0821:

  • Serological reactivity assessment:

    • Develop ELISA assays using purified recombinant TP_0708

    • Test against serum panels from patients with:

      • Different stages of syphilis (primary, secondary, latent, tertiary)

      • Other spirochetal infections (Lyme disease, leptospirosis)

      • Non-related conditions and healthy controls

    • Calculate sensitivity, specificity, positive and negative predictive values

  • Comparative diagnostic performance:

    • Compare TP_0708-based assays with currently used treponemal tests (TPPA, EIA)

    • Evaluate in combination with other T. pallidum antigens to determine if a multi-antigen approach improves performance

  • Stage-specific reactivity analysis:

    • Determine if antibody reactivity to TP_0708 correlates with specific disease stages

    • Assess potential for distinguishing active from previously treated infection

  • Point-of-care test development:

    • Evaluate TP_0708 suitability for lateral flow or other rapid test formats

    • Optimize protein concentration, buffer conditions, and detection methods

For evaluating diagnostic potential, researchers should use well-characterized serum panels and follow STARD (Standards for Reporting of Diagnostic Accuracy Studies) guidelines. Based on experience with other T. pallidum antigens like Tp0821, researchers should aim for sensitivity and specificity exceeding 90% while monitoring cross-reactivity with other spirochetal infections. Sequential testing of samples from patients throughout the course of infection and treatment can provide valuable information about the dynamics of antibody responses to TP_0708 .

What are the key experimental considerations when designing knock-out or knock-down studies of TP_0708?

Genetic manipulation of T. pallidum presents significant challenges due to the organism's fastidious nature and the limited genetic tools available. Researchers should consider the following approaches:

  • Conditional expression systems:

    • Design inducible expression constructs for TP_0708

    • Utilize tetracycline-responsive or similar regulatory elements

    • Create complementation strains to confirm phenotypes

  • Antisense RNA approaches:

    • Design antisense RNA molecules targeting TP_0708 mRNA

    • Optimize delivery methods into T. pallidum cells

    • Validate knockdown efficiency using qRT-PCR and Western blotting

  • CRISPR interference (CRISPRi):

    • Adapt dCas9-based approaches for T. pallidum

    • Design guide RNAs targeting the TP_0708 promoter region

    • Optimize expression of CRISPRi components in T. pallidum

  • Heterologous expression studies:

    • Express TP_0708 in related spirochetes like Treponema denticola

    • Create chimeric proteins with domains from TP_0708 and related proteins

    • Use these systems to assess functional aspects of TP_0708

Due to the technical challenges of directly manipulating T. pallidum genetics, researchers often employ surrogate approaches such as expressing the protein of interest in more genetically tractable organisms or developing in vitro functional assays with purified components. When interpreting results from such studies, researchers should carefully consider the limitations of these surrogate systems and validate findings through multiple complementary approaches .

How can structural information about TP_0708 inform vaccine development strategies?

Structural characterization of TP_0708 can provide valuable insights for rational vaccine design:

  • Epitope identification and optimization:

    • Analyze the TP_0708 structure to identify surface-exposed regions

    • Map conserved epitopes across T. pallidum strains

    • Engineer optimized immunogens that present key epitopes in their native conformation

  • Structure-based antigen design:

    • Identify stable, well-folded domains suitable for vaccine formulation

    • Design chimeric antigens combining key epitopes from multiple T. pallidum proteins

    • Develop multimeric presentations to enhance immunogenicity

  • Adjuvant selection and formulation:

    • Use structural information to predict protein stability in different adjuvant formulations

    • Design appropriate conjugation strategies based on available chemical groups

    • Optimize antigen presentation while maintaining critical conformational epitopes

  • Stability and manufacturing considerations:

    • Employ structural information to enhance protein thermal stability

    • Identify and engineer out potential degradation sites

    • Develop stabilized variants suitable for vaccine production and storage

Researchers developing T. pallidum vaccine candidates face unique challenges, including the organism's antigenic variation and immune evasion mechanisms. Structural information about TP_0708 can guide efforts to focus immune responses on conserved, functionally important epitopes that might be less subject to variation. Additionally, understanding the structural basis of any immunomodulatory effects of TP_0708 could help design variants that retain immunogenicity while eliminating potentially detrimental immune effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.