Recombinant Treponema pallidum Uncharacterized protein TP_0763, also referred to as TP_0763, is a protein derived from Treponema pallidum, specifically the Nichols strain . Treponema pallidum is the bacterium that causes syphilis . TP_0763 is classified as an uncharacterized protein, which means its specific function within the bacterium is not yet fully understood .
The amino acid sequence for Recombinant Treponema pallidum Uncharacterized protein TP_0763 is :
MGFLGYIYNCIRIHVSLAPIVEWRPAQAGRQYRRFPMKIKALVVLFNGALLLLCMGTGYV
LFLTPVRGTGWQSVRAYGIFFLIFLLLFLLINTLYVKNRRLLRYLDAEDWSALAALLEEE
VFTRNRVALRRVSLLSESLILLSDFEALERLEHFVHAQRPRYIMKCALTFAVGKLLAGKY
SELRTFMTRVAATQAPVQPWTRFYLAFACHLCGDFEQAHAHLLTLVHTKRQPLIRVLSAY
LLSEVLPEKLRRAPAHDAQLIARGCAHAAQVRADVHAHYTPRRWADYENRKKQNVDVLVF
LKLMQDARAWLFP
Recombinant Treponema pallidum Uncharacterized protein TP_0763 is available for purchase as an ELISA kit .
KEGG: tpa:TP_0763
Recombinant TP_0763 is a full-length protein (313 amino acids) from Treponema pallidum, the causative agent of syphilis. The protein is classified as "uncharacterized" because its precise biological function has not been fully elucidated. For research purposes, it is typically expressed in E. coli with an N-terminal His-tag to facilitate purification and detection. The recombinant form preserves the complete amino acid sequence (1-313) of the native protein while adding the affinity tag for laboratory manipulation .
The physicochemical properties of TP_0763 include:
| Property | Characteristic |
|---|---|
| Length | 313 amino acids |
| UniProt ID | O83744 |
| Source organism | Treponema pallidum (strain Nichols) |
| Recombinant expression system | E. coli (primary), also possible in yeast, baculovirus, or mammalian cells |
| Tag | N-terminal His-tag |
| Form | Lyophilized powder |
| Purity | >90% (by SDS-PAGE) |
The protein contains hydrophobic regions characteristic of membrane-associated proteins, as evidenced by segments like "VVLFNGALLLLCMGTGYV" in its sequence .
When designing experiments to characterize TP_0763, follow these systematic steps:
Define your variables: Establish dependent variables (e.g., binding affinity, enzymatic activity) and independent variables (e.g., protein concentration, temperature, pH).
Formulate testable hypotheses: Based on sequence analysis and predicted structural domains, develop specific hypotheses about potential functions.
Design appropriate controls: Include both positive controls (known proteins with similar domains) and negative controls (buffer only, unrelated proteins).
Establish measurement methods: Select techniques appropriate for your hypothesis (e.g., binding assays, activity assays, localization studies).
Plan for statistical analysis: Determine sample sizes needed for statistical significance and appropriate statistical tests .
A robust experimental design should include multiple complementary approaches, such as in vitro biochemical assays paired with cellular localization studies to triangulate function from different perspectives.
To investigate protein-protein interactions of TP_0763, consider these methodological approaches:
| Method | Advantages | Considerations |
|---|---|---|
| Pull-down assays | Identifies direct binding partners | Requires His-tagged TP_0763 |
| Co-immunoprecipitation | Detects interactions in cellular context | Requires validated antibodies |
| Yeast two-hybrid | Screens for multiple potential interactions | May yield false positives |
| Surface plasmon resonance | Provides binding kinetics | Requires purified proteins |
| Crosslinking mass spectrometry | Identifies interaction interfaces | Complex data analysis |
Begin with broader approaches like pull-down assays using the His-tagged protein to identify potential binding partners, then validate specific interactions using more targeted methods such as surface plasmon resonance .
Contradictions in scientific literature regarding TP_0763 function may stem from several factors. To resolve these discrepancies, implement this systematic approach:
Context analysis: Examine experimental conditions in contradictory studies, paying special attention to:
Species differences (strain variations of T. pallidum)
Temporal context (growth phase, time points)
Environmental conditions (temperature, pH, media composition)
Methodological comparison: Analyze differences in:
Protein preparation methods
Experimental assays and readouts
Data analysis techniques
Replication studies: Design experiments that systematically test variables that differ between contradictory studies.
Meta-analysis: When sufficient data exists, conduct formal meta-analysis of quantitative findings .
By examining the complete experimental context, many apparent contradictions can be resolved as being due to underspecified conditions rather than genuine biological disagreements.
Given the uncharacterized nature of TP_0763, structural biology approaches provide crucial insights:
X-ray crystallography: Attempt crystallization of purified His-tagged TP_0763, potentially in complex with binding partners or substrates. Crystal structures would provide atomic-level insights into functional domains.
Cryo-electron microscopy: Particularly valuable if TP_0763 exists in larger complexes or if crystallization proves challenging.
NMR spectroscopy: Useful for characterizing dynamic regions and detecting conformational changes upon ligand binding.
Computational structure prediction: Employ tools like AlphaFold to generate structural models, which can guide experimental design.
Structure-guided mutagenesis: Based on structural data, design targeted mutations to test functional hypotheses .
For optimal handling of TP_0763:
Reconstitution:
Centrifuge the vial briefly before opening
Reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (50% recommended)
Aliquot for long-term storage
Storage conditions:
Store lyophilized powder at -20°C/-80°C
Store reconstituted protein in aliquots at -20°C/-80°C
Avoid repeated freeze-thaw cycles
Working aliquots can be stored at 4°C for up to one week
Buffer compatibility:
| Expression System | Advantages | Optimization Strategies |
|---|---|---|
| E. coli | High yield, cost-effective | Lower induction temperature (16-25°C), use specialized strains for membrane proteins, optimize codon usage |
| Yeast | Post-translational modifications, membrane protein folding | Test different promoters, optimize media composition, consider inducible systems |
| Baculovirus | Complex folding, higher eukaryotic modifications | Optimize MOI, harvest timing, consider signal sequences |
| Mammalian cells | Native-like folding and modifications | Test different cell lines, optimize transfection conditions |
For E. coli expression specifically:
Test expression at different temperatures (37°C, 30°C, 25°C, 18°C)
Vary IPTG concentration (0.1-1.0 mM)
Consider fusion partners (MBP, SUMO) to enhance solubility
Test specialized E. coli strains designed for membrane or toxic proteins .
To analyze differential expression of TP_0763:
Experimental design: Include biological replicates (minimum n=3) and appropriate controls.
Quantification methods:
RT-qPCR for transcript level analysis
Western blot with anti-His antibodies or specific antibodies against TP_0763
Mass spectrometry for unbiased proteomic analysis
Data normalization: Normalize expression data against stable reference genes/proteins.
Statistical analysis: Apply appropriate statistical tests:
t-test for two-condition comparisons
ANOVA for multiple conditions
Consider non-parametric alternatives if normality assumptions aren't met
Visualization: Present data with appropriate error bars and significance indicators .
Based on sequence analysis and preliminary characterization, TP_0763 may contribute to T. pallidum pathogenesis through several mechanisms:
Membrane association: The hydrophobic regions suggest membrane localization, potentially involved in:
Host-pathogen interactions
Nutrient acquisition
Immune evasion
Signal transduction: Sequence motifs suggest possible involvement in:
Environmental sensing
Stress response pathways
Regulation of virulence factors
Experimental approaches to investigate pathogenic roles: