Recombinant Treponema pallidum Uncharacterized protein TP_0763 (TP_0763)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Treponema pallidum Uncharacterized protein TP_0763, also referred to as TP_0763, is a protein derived from Treponema pallidum, specifically the Nichols strain . Treponema pallidum is the bacterium that causes syphilis . TP_0763 is classified as an uncharacterized protein, which means its specific function within the bacterium is not yet fully understood .

Characteristics

  • Source: Treponema pallidum (Nichols strain)

  • Nature: Uncharacterized protein

  • Sequence Length: Full length protein

  • Tag Information: The tag type is determined during production .

  • Expression Region: Amino acids 1-313

  • Synonyms: Tp0763

Amino Acid Sequence

The amino acid sequence for Recombinant Treponema pallidum Uncharacterized protein TP_0763 is :
MGFLGYIYNCIRIHVSLAPIVEWRPAQAGRQYRRFPMKIKALVVLFNGALLLLCMGTGYV
LFLTPVRGTGWQSVRAYGIFFLIFLLLFLLINTLYVKNRRLLRYLDAEDWSALAALLEEE
VFTRNRVALRRVSLLSESLILLSDFEALERLEHFVHAQRPRYIMKCALTFAVGKLLAGKY
SELRTFMTRVAATQAPVQPWTRFYLAFACHLCGDFEQAHAHLLTLVHTKRQPLIRVLSAY
LLSEVLPEKLRRAPAHDAQLIARGCAHAAQVRADVHAHYTPRRWADYENRKKQNVDVLVF
LKLMQDARAWLFP

Availability

Recombinant Treponema pallidum Uncharacterized protein TP_0763 is available for purchase as an ELISA kit .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability.
Liquid formulations typically have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations generally have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TP_0763; Uncharacterized protein TP_0763
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0763
Target Protein Sequence
MGFLGYIYNCIRIHVSLAPIVEWRPAQAGRQYRRFPMKIKALVVLFNGALLLLCMGTGYV LFLTPVRGTGWQSVRAYGIFFLIFLLLFLLINTLYVKNRRLLRYLDAEDWSALAALLEEE VFTRNRVALRRVSLLSESLILLSDFEALERLEHFVHAQRPRYIMKCALTFAVGKLLAGKY SELRTFMTRVAATQAPVQPWTRFYLAFACHLCGDFEQAHAHLLTLVHTKRQPLIRVLSAY LLSEVLPEKLRRAPAHDAQLIARGCAHAAQVRADVHAHYTPRRWADYENRKKQNVDVLVF LKLMQDARAWLFP
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0763

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Treponema pallidum Uncharacterized protein TP_0763?

Recombinant TP_0763 is a full-length protein (313 amino acids) from Treponema pallidum, the causative agent of syphilis. The protein is classified as "uncharacterized" because its precise biological function has not been fully elucidated. For research purposes, it is typically expressed in E. coli with an N-terminal His-tag to facilitate purification and detection. The recombinant form preserves the complete amino acid sequence (1-313) of the native protein while adding the affinity tag for laboratory manipulation .

What are the basic physicochemical properties of TP_0763?

The physicochemical properties of TP_0763 include:

PropertyCharacteristic
Length313 amino acids
UniProt IDO83744
Source organismTreponema pallidum (strain Nichols)
Recombinant expression systemE. coli (primary), also possible in yeast, baculovirus, or mammalian cells
TagN-terminal His-tag
FormLyophilized powder
Purity>90% (by SDS-PAGE)

The protein contains hydrophobic regions characteristic of membrane-associated proteins, as evidenced by segments like "VVLFNGALLLLCMGTGYV" in its sequence .

How should I design experiments to investigate the function of TP_0763?

When designing experiments to characterize TP_0763, follow these systematic steps:

  • Define your variables: Establish dependent variables (e.g., binding affinity, enzymatic activity) and independent variables (e.g., protein concentration, temperature, pH).

  • Formulate testable hypotheses: Based on sequence analysis and predicted structural domains, develop specific hypotheses about potential functions.

  • Design appropriate controls: Include both positive controls (known proteins with similar domains) and negative controls (buffer only, unrelated proteins).

  • Establish measurement methods: Select techniques appropriate for your hypothesis (e.g., binding assays, activity assays, localization studies).

  • Plan for statistical analysis: Determine sample sizes needed for statistical significance and appropriate statistical tests .

A robust experimental design should include multiple complementary approaches, such as in vitro biochemical assays paired with cellular localization studies to triangulate function from different perspectives.

What are the best approaches for studying protein-protein interactions involving TP_0763?

To investigate protein-protein interactions of TP_0763, consider these methodological approaches:

MethodAdvantagesConsiderations
Pull-down assaysIdentifies direct binding partnersRequires His-tagged TP_0763
Co-immunoprecipitationDetects interactions in cellular contextRequires validated antibodies
Yeast two-hybridScreens for multiple potential interactionsMay yield false positives
Surface plasmon resonanceProvides binding kineticsRequires purified proteins
Crosslinking mass spectrometryIdentifies interaction interfacesComplex data analysis

Begin with broader approaches like pull-down assays using the His-tagged protein to identify potential binding partners, then validate specific interactions using more targeted methods such as surface plasmon resonance .

How can I resolve contradictory findings about TP_0763 function in the literature?

Contradictions in scientific literature regarding TP_0763 function may stem from several factors. To resolve these discrepancies, implement this systematic approach:

  • Context analysis: Examine experimental conditions in contradictory studies, paying special attention to:

    • Species differences (strain variations of T. pallidum)

    • Temporal context (growth phase, time points)

    • Environmental conditions (temperature, pH, media composition)

  • Methodological comparison: Analyze differences in:

    • Protein preparation methods

    • Experimental assays and readouts

    • Data analysis techniques

  • Replication studies: Design experiments that systematically test variables that differ between contradictory studies.

  • Meta-analysis: When sufficient data exists, conduct formal meta-analysis of quantitative findings .

By examining the complete experimental context, many apparent contradictions can be resolved as being due to underspecified conditions rather than genuine biological disagreements.

What structural approaches would help characterize TP_0763?

Given the uncharacterized nature of TP_0763, structural biology approaches provide crucial insights:

  • X-ray crystallography: Attempt crystallization of purified His-tagged TP_0763, potentially in complex with binding partners or substrates. Crystal structures would provide atomic-level insights into functional domains.

  • Cryo-electron microscopy: Particularly valuable if TP_0763 exists in larger complexes or if crystallization proves challenging.

  • NMR spectroscopy: Useful for characterizing dynamic regions and detecting conformational changes upon ligand binding.

  • Computational structure prediction: Employ tools like AlphaFold to generate structural models, which can guide experimental design.

  • Structure-guided mutagenesis: Based on structural data, design targeted mutations to test functional hypotheses .

What are the optimal conditions for reconstitution and storage of recombinant TP_0763?

For optimal handling of TP_0763:

  • Reconstitution:

    • Centrifuge the vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% recommended)

    • Aliquot for long-term storage

  • Storage conditions:

    • Store lyophilized powder at -20°C/-80°C

    • Store reconstituted protein in aliquots at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Buffer compatibility:

    • The protein is provided in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Consider buffer compatibility when designing downstream applications .

How can I optimize expression systems for TP_0763 to improve yield and solubility?

Expression SystemAdvantagesOptimization Strategies
E. coliHigh yield, cost-effectiveLower induction temperature (16-25°C), use specialized strains for membrane proteins, optimize codon usage
YeastPost-translational modifications, membrane protein foldingTest different promoters, optimize media composition, consider inducible systems
BaculovirusComplex folding, higher eukaryotic modificationsOptimize MOI, harvest timing, consider signal sequences
Mammalian cellsNative-like folding and modificationsTest different cell lines, optimize transfection conditions

For E. coli expression specifically:

  • Test expression at different temperatures (37°C, 30°C, 25°C, 18°C)

  • Vary IPTG concentration (0.1-1.0 mM)

  • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Test specialized E. coli strains designed for membrane or toxic proteins .

How should I approach differential expression analysis of TP_0763 across different experimental conditions?

To analyze differential expression of TP_0763:

  • Experimental design: Include biological replicates (minimum n=3) and appropriate controls.

  • Quantification methods:

    • RT-qPCR for transcript level analysis

    • Western blot with anti-His antibodies or specific antibodies against TP_0763

    • Mass spectrometry for unbiased proteomic analysis

  • Data normalization: Normalize expression data against stable reference genes/proteins.

  • Statistical analysis: Apply appropriate statistical tests:

    • t-test for two-condition comparisons

    • ANOVA for multiple conditions

    • Consider non-parametric alternatives if normality assumptions aren't met

  • Visualization: Present data with appropriate error bars and significance indicators .

What are the potential roles of TP_0763 in Treponema pallidum pathogenesis?

Based on sequence analysis and preliminary characterization, TP_0763 may contribute to T. pallidum pathogenesis through several mechanisms:

  • Membrane association: The hydrophobic regions suggest membrane localization, potentially involved in:

    • Host-pathogen interactions

    • Nutrient acquisition

    • Immune evasion

  • Signal transduction: Sequence motifs suggest possible involvement in:

    • Environmental sensing

    • Stress response pathways

    • Regulation of virulence factors

  • Experimental approaches to investigate pathogenic roles:

    • Knockout/knockdown studies to assess virulence

    • Immunolocalization during infection

    • Interactome analysis with host proteins

    • Comparative expression analysis between virulent and avirulent strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.