Recombinant Treponema pallidum Uncharacterized protein TP_0878 (TP_0878)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Treponema pallidum Uncharacterized Protein TP_0878

Recombinant Treponema pallidum Uncharacterized Protein TP_0878 is a protein derived from the bacterium Treponema pallidum, which is the causative agent of syphilis. This protein is expressed in Escherichia coli and is often used for research purposes, particularly in the development of vaccines and diagnostic tools. The TP_0878 protein is a full-length protein consisting of 316 amino acids and is typically fused with an N-terminal His tag for easier purification and identification .

Characteristics of Recombinant TP_0878 Protein

The recombinant TP_0878 protein is produced through recombinant DNA technology, where the gene encoding TP_0878 is inserted into a plasmid and expressed in E. coli. The protein is then purified and often provided in a lyophilized form. Key characteristics of this protein include:

CharacteristicDescription
SpeciesTreponema pallidum
SourceEscherichia coli
TagN-terminal His tag
Protein LengthFull Length (1-316 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt

Potential Applications in Vaccine Development

Recombinant proteins like TP_0878 are valuable in vaccine development due to their ability to stimulate immune responses. Although TP_0878 is not specifically characterized, its use in research settings could contribute to understanding the immune interactions with Treponema pallidum and potentially aid in developing more effective vaccines against syphilis .

References Creative Biomart. (2025). Recombinant Full Length Treponema pallidum Uncharacterized Protein TP_0878 (TP_0878) Protein, His-Tagged. PMC. (2020). Recombinant Treponema pallidum protein Tp0768 promotes the production of IL-1β, IL-6, and IL-8 by macrophages. BioRxiv. (2024). Development and utilization of Treponema pallidum expressing green fluorescent protein to study spirochete-host interactions and antibody-mediated clearance. PubMed. (2024). Treponema pallidum recombinant protein Tp0768 enhances the neutrophil chemotaxis in endothelial cells. Creative Biolabs. (n.d.). Recombinant Treponema Pallidum TP_0878 Protein (aa 1-316). MedNexus. (2024). Research progress on the ultrastructure of Treponema pallidum. NCBI Bookshelf. (n.d.). Syphilis - StatPearls. PMC. (2025). Tp40: a new potential prognostic and diagnostic marker for syphilis. PubMed. (2020). Recombinant proteins for vaccine development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for tailored fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TP_0878; Uncharacterized protein TP_0878
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0878
Target Protein Sequence
MRSVDSRSSVTRWVCLTSVILFCFCIAVMRYGGVKKRRYFYGFCLHPRERADITEVILRF PREERNASRELRWVKKDRQWFIQLAHAIHPAKQEVLERLFQYLFTKRRFEFITNNTRFFS DYALGKQPAVQMKFTKKNGAAIGDIYFGALNGTGLGRYIRIGDNAAVFLTEDDFTPFFRD EKRFWCDTRQFHELFTQSQIQMMEVSGKYIVRSRTSVVFKEVEQFFARFSYVDVGPTPTQ WKESIVIHRGDGKIIRFRLQPAAHQEWTLWDAQSVHAYTLSAYTARYLFALISRMQTETG MSSLQQFDTEENLISD
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0878

STRING: 243276.TP0878

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Treponema pallidum TP_0878 and why is it classified as "uncharacterized"?

TP_0878 is a protein encoded by the genome of Treponema pallidum (strain Nichols). It is classified as "uncharacterized" because its precise biological function remains unknown despite genomic sequencing of T. pallidum. The protein has been identified through genomic analysis but has not been fully characterized in terms of its structure, function, or role in bacterial physiology or pathogenesis .

The difficulty in studying T. pallidum proteins stems largely from the historical inability to culture the organism in laboratory conditions. As noted by Dr. Steven Norris, "The organism never touches the ground. It's only found in humans. It's not found anywhere else in nature." This host dependency has significantly hampered research on T. pallidum proteins, including TP_0878 .

What structural information is currently available for TP_0878?

Based on available data, TP_0878 is a protein spanning amino acids 1-316 in its full-length form. Structural information remains limited due to the challenges in expressing and purifying sufficient quantities of the protein for crystallography or other structural biology techniques .

Preliminary structural predictions may be available through computational methods, but experimental validation of these predictions has been limited by the technical challenges associated with T. pallidum research. The helically coiled nature of T. pallidum (approximately 6–15 μm long and 0.1–0.326 μm wide) suggests that its membrane proteins, potentially including TP_0878, may have specialized structural adaptations for this unique bacterial morphology .

How does recombinant expression of TP_0878 help overcome research limitations?

Recombinant expression of TP_0878 provides a crucial workaround to the cultivation challenges of T. pallidum. By expressing the protein in more amenable host systems such as E. coli, yeast, baculovirus-infected insect cells, or mammalian cells, researchers can obtain sufficient quantities of the protein for structural and functional studies .

This approach offers several advantages:

  • Production of the protein independent of T. pallidum cultivation

  • Ability to introduce tags for purification and detection

  • Option to express specific domains or modified versions of the protein

  • Capability to scale up production for various experimental applications

Despite these advantages, researchers must validate that recombinantly expressed TP_0878 maintains relevant structural and functional properties compared to the native protein.

What are the optimal expression systems for recombinant TP_0878 production?

The selection of an expression system for TP_0878 should be based on several factors including required post-translational modifications, solubility concerns, and downstream applications.

Expression SystemAdvantagesLimitationsRecommended for TP_0878
E. coliHigh yield, low cost, rapid expressionLimited post-translational modifications, inclusion body formation possibleInitial structural studies, antigen production
YeastEukaryotic post-translational modifications, good foldingLower yields than E. coli, longer production timeStudies requiring some post-translational modifications
Baculovirus/Insect cellsComplex eukaryotic post-translational modifications, good for membrane proteinsHigher cost, technical complexityFunctional studies, especially if membrane-associated
Mammalian cellsMost authentic post-translational modificationsHighest cost, lowest yield, most complexStudies requiring native-like protein conformation

For TP_0878, expression challenges may include protein hydrophobicity, codon usage bias, and potential toxicity to the host. Researchers often need to analyze the protein sequence and secondary structure to optimize expression conditions .

For transmembrane segments (if present in TP_0878), special consideration should be given to the expression system. The MNP platform described in some research extracts high-purity nanoscale cell membrane particles while maintaining the conformation and activity of membrane proteins, which might be beneficial if TP_0878 has membrane-associated domains .

How has the recent breakthrough in T. pallidum cultivation impacted research on proteins like TP_0878?

The breakthrough in culturing T. pallidum reported by Dr. Norris and colleagues represents a significant advancement that could fundamentally change how proteins like TP_0878 are studied. Their co-incubation system using rabbit epithelial cells supplemented with amino acids has demonstrated continuous growth of T. pallidum for nearly eight months while maintaining infectivity .

This cultivation system could impact TP_0878 research in several ways:

  • Direct isolation: Potentially allowing isolation of native TP_0878 from cultured bacteria

  • Expression studies: Enabling research on natural expression patterns and regulation

  • Knockout/modification studies: Possibly facilitating genetic manipulation to understand protein function

  • Interaction studies: Providing a system to study protein-protein interactions in a more natural context

The researchers noted that "a long-term culture system could bolster genetic, pathologic, and immunologic research of T. pallidum," which would directly benefit studies of uncharacterized proteins like TP_0878 .

What computational approaches can predict TP_0878 function while awaiting experimental validation?

While experimental characterization remains challenging, several computational approaches can provide insights into potential TP_0878 functions:

  • Sequence homology analysis: Identifying distant homologs in other organisms may provide functional clues

  • Structural prediction: Tools like AlphaFold2 can predict protein structure, potentially revealing functional domains

  • Protein-protein interaction prediction: Computational methods can suggest potential interaction partners

  • Genomic context analysis: Examining neighboring genes may indicate functional relationships

  • Conservation analysis: Studying conservation patterns across different T. pallidum strains may highlight functionally important regions

As noted in the search results, AI-based protein structure prediction technologies are becoming increasingly powerful for understanding protein function, especially for previously uncharacterized proteins .

What purification strategies are most effective for maintaining TP_0878 native conformation?

Purifying recombinant TP_0878 while maintaining its native conformation requires careful consideration of several factors:

  • Expression tags: Using fusion tags on both ends can help distinguish full-length proteins from truncated products, particularly important when dealing with uncharacterized proteins like TP_0878. Increasing imidazole concentration at elution can improve selectivity for full-length proteins .

  • Purification conditions: Buffer optimization is critical, with considerations for:

    • pH and ionic strength

    • Presence of stabilizing agents

    • Reducing agents if cysteine residues are present

    • Detergents if membrane-associated domains exist

  • Quality control: Multiple techniques should be employed to verify protein integrity:

    • Size exclusion chromatography to assess aggregation state

    • Circular dichroism to evaluate secondary structure

    • Thermal shift assays to determine stability

    • Activity assays if functional hypotheses exist

For transmembrane proteins or membrane-associated proteins, specialized approaches such as nanodiscs or amphipols may help maintain native conformations during purification .

How can researchers validate potential functions of TP_0878?

Validating the function of an uncharacterized protein like TP_0878 requires a multi-faceted approach:

  • Interaction studies: Co-immunoprecipitation and pull-down assays can identify protein binding partners, providing clues to function. The search results describe successful two-way co-immunoprecipitation techniques used for other proteins that could be adapted for TP_0878 studies .

  • Localization studies: Determining where TP_0878 localizes within T. pallidum cells can suggest functional roles. With the new cultivation system, immunofluorescence or immunogold electron microscopy might be possible .

  • Heterologous expression: Expressing TP_0878 in other bacterial species and observing phenotypic changes.

  • Domain deletion analysis: Creating truncated versions to identify functional domains.

  • Signaling pathway analysis: If TP_0878 is hypothesized to participate in signaling, techniques such as phosphorylation state analysis might be informative. The search results describe approaches using western blot analysis to assess protein phosphorylation that could be adapted .

What experimental considerations are important when designing antibodies against TP_0878?

Developing effective antibodies against TP_0878 requires:

  • Epitope selection: Computational analysis to identify surface-exposed, antigenic regions that are:

    • Not heavily glycosylated

    • Relatively conserved across strains

    • Not homologous to host proteins

  • Antibody format selection: Considerations include:

    • Polyclonal vs. monoclonal approaches

    • Full IgG vs. smaller formats (Fab, scFv)

    • Species selection for immunization

  • Validation strategies:

    • Western blot against recombinant and native protein (if available)

    • Immunoprecipitation efficiency assessment

    • Cross-reactivity testing against related proteins

    • Functional neutralization assays if applicable

  • Application optimization: Different applications (Western blot, immunofluorescence, flow cytometry) may require different antibody characteristics.

How might TP_0878 contribute to syphilis vaccine development efforts?

While the specific role of TP_0878 in pathogenesis remains uncharacterized, its potential contribution to vaccine development includes:

  • Antigen evaluation: As a recombinant protein, TP_0878 could be systematically evaluated as a vaccine antigen candidate. The search results indicate that recombinant T. pallidum proteins are being considered for vaccine development applications .

  • Epitope mapping: Identifying immunogenic epitopes within TP_0878 that elicit protective antibody responses.

  • Conserved antigen evaluation: If TP_0878 is conserved across T. pallidum strains, it may represent a broadly protective target.

  • Combinatorial approaches: Even if not immunogenic alone, TP_0878 might enhance vaccine efficacy when combined with other antigens.

The challenge of growing T. pallidum in culture has historically hampered syphilis vaccine development. The breakthrough cultivation system may accelerate the evaluation of proteins like TP_0878 as vaccine candidates by allowing more direct testing of protective immunity .

What role might TP_0878 play in T. pallidum pathogenesis or host-pathogen interactions?

Without definitive functional characterization, several approaches can help explore TP_0878's potential role in pathogenesis:

  • Expression analysis: Determining if TP_0878 expression changes during different stages of infection.

  • Immune response analysis: Evaluating if syphilis patients develop antibodies against TP_0878, suggesting exposure to the immune system.

  • Comparative genomics: Assessing if TP_0878 is present in non-pathogenic treponemes vs. pathogenic subspecies.

  • Host cell interaction studies: Testing if recombinant TP_0878 binds to human cells or specific cellular components.

  • Signaling pathway analysis: Investigating if TP_0878 interferes with host immune signaling pathways.

The recent cultivation breakthrough may allow for more direct study of T. pallidum-host interactions, potentially clarifying the role of proteins like TP_0878 in pathogenesis .

How can structural biology approaches advance understanding of TP_0878?

Structural biology offers powerful approaches for understanding uncharacterized proteins:

  • X-ray crystallography: Requires purified, crystallizable protein to determine atomic-level structure.

  • Cryo-electron microscopy: May allow structural determination without crystallization, particularly valuable for membrane-associated proteins.

  • NMR spectroscopy: Provides information on protein dynamics in addition to structure.

  • Small-angle X-ray scattering: Offers low-resolution structural information in solution.

  • AI-based prediction: Tools like AlphaFold2 can predict protein structures with increasing accuracy, potentially revealing functional domains in TP_0878 .

The search results highlight that "with the development of AI-based protein structure prediction technologies such as AlphaFold2, the ability of these technologies to predict the three-dimensional structure of unknown proteins will become even more powerful in the future" . This is particularly relevant for challenging proteins like TP_0878.

What are common troubleshooting approaches for TP_0878 expression problems?

Common expression challenges for T. pallidum proteins like TP_0878 include:

ChallengePossible Solutions
Poor expressionCodon optimization, lower induction temperature, different promoter strength
Inclusion body formationFusion tags (SUMO, MBP, TRX), co-expression with chaperones, reduced induction
Protein toxicityTightly regulated expression systems, cell-free expression systems
Truncated productsOptimize translation initiation, use fusion tags on both ends, increase imidazole concentration during purification
Membrane associationDetergent screening, amphipols, nanodiscs, fragment-based expression

The search results specifically note that "when expressing full-length proteins, problems with truncated products may be encountered... To ensure the acquisition of full-length proteins, expression vectors with fusion labels on both ends can be used to distinguish full-length proteins from truncated proteins by increasing the imidazole concentration at elution" .

How can researchers distinguish between experimental artifacts and genuine findings when working with TP_0878?

When working with poorly characterized proteins like TP_0878, distinguishing artifacts from genuine findings requires:

  • Multiple expression systems: Comparing protein behavior when expressed in different systems.

  • Different purification strategies: Ensuring observations are not artifacts of a particular purification method.

  • Functional controls: Including well-characterized proteins in experiments to validate techniques.

  • Native comparison: When possible, comparing recombinant protein properties with those of native protein.

  • Replication and statistical analysis: Ensuring observations are reproducible and statistically significant.

The continuous culture system developed for T. pallidum may eventually allow for direct comparison between recombinant and native TP_0878, providing a gold standard for validating experimental findings .

What collaboration approaches can accelerate research on TP_0878?

Research on uncharacterized proteins benefits from interdisciplinary collaboration:

  • Structural biology-microbiology partnerships: Combining expertise in protein expression/structure with T. pallidum biology.

  • Computational-experimental teams: Using computational predictions to guide targeted experiments.

  • Immunology-microbiology collaboration: Evaluating immune responses to TP_0878 and potential immunomodulatory functions.

  • Multi-center resource sharing: Sharing recombinant proteins, antibodies, and other resources to accelerate research.

  • Industry-academic partnerships: Leveraging industry capabilities for protein production and characterization.

The breakthrough in T. pallidum cultivation offers new opportunities for collaboration, as researchers can now potentially study the bacterium directly rather than relying solely on recombinant approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.