Recombinant Treponema pallidum Uncharacterized protein TP_0976 (TP_0976)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TP_0976; Uncharacterized protein TP_0976
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-459
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_0976
Target Protein Sequence
MVLTQKNLVKRTTESTETEAVSDLLVSELLILGLSLPALLRPFSRQSRKISAIPLLPVLA LSVGALTVLGQGLTLDLTLSLVSSSVVCLTELPRLVAFSQGIPNDLYSAGARIARVLLLV AGVFTLVIVCLCAPEPGYRPSRSVVRSSFSLRLGNTKVNAGLLLSLANPYETSHLDNPSA PHPSENPQSRAHPKQNPVGVNVVVLKNTPQSAHRAHPETLELMLAERGYTVFVPYQDAYS PSYSAASLAAPMRTSPGVVLLSSALRGVPFDVPTPYVSRRANTIDAATFEDAHVPALFPA LFALCRHAPTFVYAESAHEVMLSRFLQQQPHACAGVFFVLPDSAARGPHHAPAVQGAPPP VDTAGVASAVRGASRTLPAVYRQYVHAAEAAWAELASTDILAAYLAGLPRDRHRTRLQAR ATQVDQWIRAQLHLSEPVLPHAQALSHHTVHAGGTYDRT
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_0976

STRING: 243276.TP0976

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Treponema pallidum TP_0976 protein?

TP_0976 is an uncharacterized protein identified in Treponema pallidum, the spirochete bacterium responsible for syphilis. In the reference Nichols strain, this protein consists of 459 amino acids, while variant forms exist in other strains such as the Chicago strain, where it appears to be 491 amino acids in length due to genetic variations . This protein remains functionally uncharacterized, making it an important research target for understanding T. pallidum biology and pathogenesis. Methodologically, researchers typically approach uncharacterized proteins through sequence analysis, structural prediction, expression studies, and comparative genomics to establish hypotheses about potential functions.

What are the known structural characteristics of TP_0976?

The protein is derived from Treponema pallidum strain Nichols and is officially classified as an "uncharacterized protein" . While detailed structural information remains limited, researchers can utilize computational approaches including secondary structure prediction, domain identification, and 3D modeling to generate structural hypotheses. The methodological pathway involves:

  • Protein sequence analysis using tools like BLAST, Pfam, and InterPro

  • Secondary structure prediction using PSIPRED or JPred algorithms

  • Tertiary structure prediction using homology modeling or ab initio approaches

  • Laboratory validation through circular dichroism, X-ray crystallography, or NMR spectroscopy

The protein's length varies between strains (459aa in Nichols vs. 491aa in Chicago), suggesting potential structural differences that may influence function . These variations provide natural structural mutants for comparative functional studies.

How is recombinant TP_0976 produced for research purposes?

Recombinant TP_0976 protein can be produced using several expression systems, including E. coli, yeast, baculovirus, or mammalian cells . The methodological workflow involves:

  • Gene synthesis or PCR amplification of the TP_0976 coding sequence

  • Cloning into an appropriate expression vector with affinity tags

  • Transformation/transfection into the selected expression system

  • Optimization of expression conditions (temperature, induction parameters)

  • Protein purification using chromatography techniques

  • Verification of protein identity through mass spectrometry, Western blotting

  • Quality control to ensure proper folding and absence of aggregation

For T. pallidum proteins, E. coli expression systems are commonly employed due to their efficiency, though challenges with protein folding may necessitate alternative systems for certain applications. Purification typically involves affinity chromatography targeting fusion tags, followed by additional purification steps to achieve high purity for experimental use.

What genomic variations exist in TP_0976 across T. pallidum strains?

Significant genomic variations have been documented in the TP_0976 gene across T. pallidum strains. Comparative genomic analysis between the Chicago and Nichols strains revealed a G deletion in the Chicago strain (TPChic0976) that alters the protein length to 491 amino acids compared to 459 amino acids in the Nichols strain . This variation represents a potentially important functional difference between strains.

StrainLocus TagNucleotide ChangeProtein Length (aa)Confirmation Status
ChicagoTPChic0976G deletion491Not confirmed by DT-sequencing
NicholsTP0976Reference sequence459Reference strain

Methodologically, researchers investigating strain variations should:

  • Perform PCR amplification and sequencing across multiple strains

  • Map variations to functional domains using bioinformatic tools

  • Determine whether variations affect coding regions or regulatory elements

  • Assess the impact of length differences on protein structure and function

What techniques are essential for initial characterization of TP_0976?

Initial characterization of TP_0976 requires a multi-technique approach:

  • Genomic analysis:

    • PCR amplification and sequencing to confirm the gene sequence

    • Comparison across strains to identify conserved regions

    • Analysis of genetic context and potential operon structure

  • Expression analysis:

    • RT-PCR or RNA-Seq to verify transcription

    • Quantitative PCR to measure expression levels under different conditions

    • Identification of potential regulatory elements

  • Protein characterization:

    • Recombinant protein expression and purification

    • SDS-PAGE and Western blotting for size verification

    • Circular dichroism for secondary structure assessment

    • Mass spectrometry for exact mass determination

  • Localization studies:

    • Cellular fractionation to determine subcellular location

    • Immunofluorescence if antibodies are available

    • Computational prediction of signal peptides or transmembrane domains

These techniques provide foundation data essential for developing more targeted functional studies.

How might genomic variations in TP_0976 impact protein function?

The documented G deletion in the Chicago strain that changes the protein length from 459aa to 491aa likely has significant functional implications . A methodological approach to investigating these impacts includes:

  • Computational structure prediction of both variants to identify structural differences

  • Expression and purification of both variants for direct functional comparison

  • Site-directed mutagenesis to recreate specific variations in a controlled context

  • Comparative binding assays to identify potential differences in interaction partners

  • Stability assessments to determine if structural variations affect protein half-life

  • In vitro and cell-based functional assays comparing both variants

Such studies may reveal whether length variations represent functional adaptations or neutral mutations, providing insight into the protein's role in T. pallidum biology.

What potential role might TP_0976 play in T. pallidum pathogenesis?

While the function of TP_0976 remains uncharacterized, several methodological approaches can help elucidate its potential role in pathogenesis:

  • Expression analysis during infection:

    • Measure transcript levels at different infection stages

    • Determine if expression is induced by host factors

    • Compare expression between virulent and attenuated strains

  • Interaction studies:

    • Screen for binding to host extracellular matrix components

    • Test interaction with immune system components

    • Investigate potential role in immune evasion

  • Comparative genomics:

    • Analyze conservation across pathogenic and non-pathogenic treponemes

    • Identify evolutionary signatures of selection

    • Compare with homologs in other bacterial pathogens

  • Functional screening:

    • Test for specific enzymatic activities

    • Assess impact on host cell processes when added exogenously

    • Determine effects on host gene expression

These approaches collectively provide a framework for generating testable hypotheses about the protein's role in disease.

How can homopolymeric tracts influence TP_0976 expression and function?

Homopolymeric nucleotide tracts have been documented to influence gene expression in T. pallidum through mechanisms such as slipped-strand mispairing during DNA replication . While specific data on homopolymeric sequences in the TP_0976 gene is not presented in the provided sources, such sequences could potentially impact this protein's expression through:

  • Transcriptional regulation:

    • Poly-G tracts in promoter regions can influence transcription initiation

    • Length variations in homopolymeric tracts can create phase variation mechanisms

    • Changes in repeat length may alter binding of transcriptional regulators

  • Translational effects:

    • Frameshifts due to insertion/deletion events in coding regions

    • Altered reading frames producing different protein variants

    • Changed mRNA stability due to secondary structure formation

Methodologically, researchers should:

  • Sequence the TP_0976 gene and regulatory regions across multiple strains

  • Identify and characterize any homopolymeric tracts

  • Measure transcription with variable repeat lengths using reporter constructs

  • Compare protein expression levels across strains with different repeat structures

What approaches can resolve contradictory findings in TP_0976 research?

Research on uncharacterized proteins frequently generates contradictory findings. A systematic methodological approach to resolution includes:

  • Standardization of experimental conditions:

    • Use identical protein constructs and expression systems

    • Employ consistent assay conditions and protocols

    • Document all methodological details comprehensively

  • Strain variation considerations:

    • Sequence verification of the specific strain used in each study

    • Direct comparison of protein variants from different strains

    • Clear documentation of strain provenance and passage history

  • Multiple validation approaches:

    • Employ orthogonal techniques to verify findings

    • Use both in vitro and in vivo/ex vivo systems

    • Collaborate across laboratories for independent verification

  • Systematic troubleshooting:

    • Design experiments specifically to address contradictions

    • Test boundary conditions where differences emerge

    • Identify variables that may explain discrepancies

This structured approach helps distinguish true biological variation from technical artifacts.

How can structural analysis contribute to understanding TP_0976 function?

Structural analysis represents a powerful approach for functional prediction of uncharacterized proteins like TP_0976. The methodological workflow should include:

  • Computational structure prediction:

    • Use AlphaFold or other modern prediction algorithms

    • Generate models for both strain variants

    • Identify potential functional domains and active sites

  • Structural comparison:

    • Search for structural homologs even when sequence homology is limited

    • Map conserved residues onto the predicted structure

    • Identify potential binding pockets or catalytic sites

  • Experimental structure determination:

    • Express and purify protein for structural studies

    • Use X-ray crystallography, cryo-EM, or NMR as appropriate

    • Generate structures of protein complexes when possible

  • Structure-guided functional analysis:

    • Design mutations based on structural insights

    • Conduct molecular docking studies to predict binding partners

    • Develop structure-based functional hypotheses

These approaches provide a rational pathway from structure to function prediction.

What are effective experimental designs for functional characterization of TP_0976?

Functional characterization of an uncharacterized protein requires a systematic experimental design:

  • Initial bioinformatic characterization:

    • Sequence analysis across species to identify conserved domains

    • Prediction of subcellular localization and post-translational modifications

    • Genomic context analysis to identify functional associations

  • Expression and purification optimization:

    • Test multiple expression systems (E. coli, yeast, mammalian cells)

    • Optimize conditions to ensure proper folding

    • Develop purification protocols that maintain native conformation

  • Functional screening cascade:

    • Begin with broad activity assays (enzymatic, binding)

    • Progress to targeted assays based on preliminary findings

    • Validate findings with multiple complementary approaches

  • Structure-function relationships:

    • Generate truncation constructs to identify functional domains

    • Conduct site-directed mutagenesis of predicted key residues

    • Correlate structural features with functional properties

  • Biological context analysis:

    • Determine expression patterns during infection

    • Identify potential interaction partners

    • Assess impact on virulence-associated phenotypes

This systematic approach maximizes the likelihood of functional discovery for previously uncharacterized proteins.

How can researchers effectively study TP_0976 interactions with host factors?

Investigating potential interactions between TP_0976 and host factors requires specialized methodological approaches:

  • Initial interaction screening:

    • Bacterial two-hybrid or yeast two-hybrid screening

    • Protein microarray screening against host proteins

    • Pull-down assays using recombinant protein as bait

  • Interaction validation:

    • Co-immunoprecipitation from infection models when possible

    • Surface plasmon resonance for quantitative binding analysis

    • Microscopy-based co-localization in cellular models

  • Functional characterization of interactions:

    • Competition assays to determine binding specificity

    • Mutagenesis of predicted interaction interfaces

    • Inhibition studies to assess biological relevance

  • Host response analysis:

    • Transcriptomic/proteomic analysis of cells exposed to TP_0976

    • Signaling pathway activation studies

    • Immune response measurements

These approaches collectively build a comprehensive picture of the protein's role in host-pathogen interactions.

What bioinformatic tools are most effective for analyzing TP_0976?

Computational analysis of TP_0976 requires a strategic selection of bioinformatic tools:

  • Sequence analysis:

    • BLAST and PSI-BLAST for homology identification

    • Clustal Omega for multiple sequence alignment

    • HMMER for sensitive profile-based searches

  • Structural prediction:

    • AlphaFold for 3D structure prediction

    • PSIPRED for secondary structure analysis

    • TMHMM for transmembrane domain prediction

  • Functional prediction:

    • InterProScan for domain and motif identification

    • ConSurf for evolutionary conservation mapping

    • 3DLigandSite for binding site prediction

  • Comparative genomics:

    • ACT (Artemis Comparison Tool) for genomic context analysis

    • STRING for functional association networks

    • PATRICBrc for bacterial genome comparison

  • Specialized analyses:

    • SignalP for signal peptide prediction

    • NetOGlyc/NetNGlyc for glycosylation site prediction

    • PRED-LIPO for lipoprotein prediction

This integrated computational approach generates testable hypotheses to guide experimental design.

How should researchers approach differences in strain variants of TP_0976?

The documented differences between TP_0976 variants across T. pallidum strains (459aa in Nichols vs. 491aa in Chicago) present both challenges and opportunities. A methodological approach includes:

  • Comprehensive sequence analysis:

    • Sequence the gene from multiple clinical and laboratory strains

    • Identify patterns of variation (conserved vs. variable regions)

    • Determine if variations cluster in specific domains

  • Comparative expression analysis:

    • Measure transcript levels across strains

    • Determine if protein expression levels correlate with sequence variations

    • Analyze potential differences in regulation

  • Functional comparison:

    • Express and purify proteins from multiple strains

    • Compare biochemical properties and activity profiles

    • Assess if variations affect interactions with host factors

  • Structure-function correlation:

    • Generate structural models of different variants

    • Identify structural differences caused by sequence variations

    • Test functional implications of structural differences

This approach transforms strain variation from a confounding factor into a valuable tool for understanding protein function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.