Recombinant Treponema pallidum UPF0073 membrane protein TP_1037 (TP_1037)

Shipped with Ice Packs
In Stock

Description

Introduction to Treponema pallidum and TP_1037

Treponema pallidum is the causative agent of venereal syphilis, a sexually transmitted infection that remains a significant global health concern. This bacterium possesses unique structural and physiological characteristics that contribute to its pathogenicity and ability to establish persistent infection. The outer membrane (OM) of T. pallidum has long been a subject of scientific interest due to its role in mediating host-pathogen interactions and immune evasion strategies . Among the various proteins identified in the T. pallidum genome, TP_1037 stands out as a membrane protein of particular interest due to its potential role in pathogenesis.

TP_1037 is classified as a member of the UPF0073 protein family, a group of uncharacterized membrane proteins present in various bacterial species. The designation "UPF" (Uncharacterized Protein Family) indicates that while the protein has been identified and sequenced, its precise biological function remains incompletely understood. Nevertheless, genomic and transcriptomic analyses have provided valuable insights into the expression patterns and potential functions of this protein in T. pallidum.

Transcriptome profiling of T. pallidum has revealed that TP_1037 is actively expressed during infection, with relative expression values indicating its potential significance in the bacterium's lifecycle . The protein has been annotated as Hemolysin III (hlyIII), suggesting a possible role in membrane disruption and cytolytic activity that could contribute to tissue invasion and nutrient acquisition during infection.

Predicted Structure and Function

While the three-dimensional structure of TP_1037 has not been experimentally determined, bioinformatic analyses provide insights into its potential structural organization. As a member of the hemolysin family, TP_1037 likely shares structural features with other bacterial hemolysins, including hydrophobic transmembrane domains that facilitate insertion into target membranes.

The T. pallidum outer membrane has been characterized as containing relatively few integral membrane proteins compared to other bacteria, making those that are present, like TP_1037, potentially significant for host-pathogen interactions . Recent advances in computational tools have enabled researchers to predict protein structures based on sequence homology and physicochemical properties, suggesting that TP_1037 may form amphiphilic structures capable of disrupting membrane integrity.

Expression Systems

Recombinant TP_1037 has been successfully expressed in Escherichia coli expression systems, providing a valuable source of purified protein for structural and functional studies . The recombinant protein typically includes an N-terminal polyhistidine (His) tag to facilitate purification through affinity chromatography. This approach has overcome the traditional challenges associated with studying T. pallidum proteins, as the organism itself cannot be continuously cultured in vitro.

The production of recombinant TP_1037 typically employs the following parameters:

ParameterSpecification
Expression HostE. coli
Fusion TagN-terminal His tag
Protein LengthFull Length (1-238 amino acids)
Accession NumberO84000
Final FormLyophilized powder

Purification Methods

The purification of recombinant TP_1037 protein involves several chromatographic steps to achieve high purity suitable for research applications. Following expression in E. coli, the bacterial cells are typically lysed, and the His-tagged protein is isolated using nickel affinity chromatography. Additional purification steps may include size exclusion chromatography to remove aggregates and contaminants.

The final purified product generally exhibits greater than 90% purity as determined by SDS-PAGE analysis . The purified protein is often supplied as a lyophilized powder for extended shelf life and stability, with recommendations for reconstitution in deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL. For long-term storage, the addition of 5-50% glycerol (with 50% being the common default) and storage at -20°C or -80°C is recommended to maintain protein integrity and activity .

Hemolysin Activity

Transcriptomic studies of T. pallidum have classified TP_1037 as Hemolysin III (hlyIII), suggesting a role in membrane disruption and potentially contributing to the pathogen's virulence . Hemolysins are proteins capable of lysing red blood cells by disrupting the cell membrane, an activity that may provide access to nutrients and contribute to tissue damage during infection.

The relative expression value of TP_1037 has been reported as 1.1 in transcriptome analyses, indicating active expression during infection . This level of expression suggests that the protein plays a functional role in T. pallidum biology, potentially contributing to its survival within the host.

Role in Pathogenesis

The outer membrane of T. pallidum serves as a critical interface between the bacterium and its host, mediating adhesion, nutrient acquisition, and immune evasion . As a membrane protein, TP_1037 may contribute to these processes, although its specific role in pathogenesis remains to be fully elucidated.

The poor surface antigenicity of T. pallidum has been attributed to the unique properties of its outer membrane, which contains relatively few exposed proteins compared to other bacteria . This characteristic is thought to contribute to the organism's ability to evade host immune responses and establish persistent infection. The contribution of TP_1037 to this phenomenon warrants further investigation.

Diagnostic Potential

Recombinant T. pallidum proteins have shown promise as components of serological diagnostic tests for syphilis. While current diagnostic approaches primarily rely on detecting antibodies against other T. pallidum antigens, the potential utility of TP_1037 as a diagnostic marker deserves consideration.

The unique sequence and potential antigenic properties of TP_1037 could provide a basis for developing more specific diagnostic assays for T. pallidum infection. Recombinant production of the protein facilitates its incorporation into enzyme immunoassays or other serological platforms that could enhance the sensitivity and specificity of syphilis diagnosis.

Vaccine Development

The identification and characterization of membrane proteins like TP_1037 contribute to ongoing efforts to develop a vaccine against syphilis. Membrane proteins represent potential targets for protective antibody responses that could neutralize the pathogen or enhance its clearance by the immune system.

Although the relatively poor surface antigenicity of T. pallidum presents challenges for vaccine development , recombinant proteins offer opportunities to induce immune responses against specific bacterial components. Further research is needed to evaluate the immunogenicity and protective potential of TP_1037 in this context.

Genomic Analysis

Recent advances in whole-genome sequencing of T. pallidum strains have enhanced our understanding of the genetic diversity within this species and the potential functional implications of genetic variations . While these studies have primarily focused on characterizing novel strains and understanding the genetic basis of clinical presentations, they provide a foundation for investigating potential variations in membrane proteins like TP_1037 across different isolates.

The identification of a novel T. pallidum strain (NYMC01) associated with a painful oral lesion exemplifies the ongoing efforts to correlate genetic variations with clinical manifestations . Although this research did not specifically focus on TP_1037, similar approaches could reveal whether variations in this protein contribute to differences in pathogenicity or clinical presentation among T. pallidum strains.

Transcriptomic Analysis

Transcriptomic studies have provided valuable insights into the expression patterns of T. pallidum genes during infection, including the relative expression levels of membrane proteins like TP_1037 . These analyses contribute to our understanding of the bacterium's adaptation to the host environment and the potential roles of specific proteins in pathogenesis.

The classification of TP_1037 as a hemolysin based on genomic annotations and expression data provides a foundation for further functional studies to confirm and characterize this activity. Integration of transcriptomic data with proteomic and functional analyses offers a comprehensive approach to understanding the biological significance of TP_1037 in T. pallidum.

Functional Characterization

Despite the classification of TP_1037 as a hemolysin, direct experimental evidence of its hemolytic activity and the mechanism by which it disrupts membranes remains to be established. Future research should focus on demonstrating the functional properties of recombinant TP_1037 through in vitro assays measuring membrane disruption, hemolysis, or interactions with host cells.

Site-directed mutagenesis of key residues within the protein could provide insights into the structural determinants of its function and potentially identify targets for therapeutic intervention. Additionally, investigating the regulation of TP_1037 expression in response to environmental cues could enhance our understanding of its role in T. pallidum pathogenesis.

Immunological Studies

The immunological properties of TP_1037, including its antigenicity and potential to elicit protective immune responses, represent important areas for future investigation. Studies evaluating the antibody responses to recombinant TP_1037 in individuals with syphilis could provide insights into its exposure to the immune system during natural infection and its potential as a vaccine candidate.

Determining whether antibodies against TP_1037 can neutralize its activity or enhance bacterial clearance would contribute to understanding its significance in host-pathogen interactions and potential utility in immunoprophylaxis.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for tailored fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life is influenced by storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TP_1037; UPF0073 membrane protein TP_1037
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-238
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
TP_1037
Target Protein Sequence
MEKIVNADGSDAICPASAACAKSIRSYQESYSLGEEIANAVTHGIGVGLSIVALVLLVVR AVHYTPADLTARYVVGFSVFGSSLIVLYLCSTLYHALPRGAKYVFGVIDHCCIYVLIAGT YTASCLTTLYGAIGWTVFGVIWGLACSGSVIYSVFGHRVRWLSLVMYIAMGWLVVFVAKP LRERLPEISFLFLVLGGVLYTVGCVFYALKRIKWTHTIWHMFVIGGSVMHFFSLYLSF
Uniprot No.

Target Background

Database Links

KEGG: tpa:TP_1037

STRING: 243276.TP1037

Protein Families
UPF0073 (Hly-III) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Treponema pallidum UPF0073 membrane protein TP_1037?

TP_1037 is a membrane protein encoded by the Treponema pallidum genome, specifically by the TP_1037 gene. It belongs to the UPF0073 protein family, with a full length of 238 amino acids. This protein is structurally characterized as a membrane-associated component of the syphilis spirochete and may play roles in membrane integrity, transport functions, or host-pathogen interactions. The protein has been successfully expressed in recombinant systems, particularly with N-terminal His-tags in E. coli expression systems, facilitating purification and subsequent research applications .

How does TP_1037 compare structurally and functionally to other Treponema pallidum membrane proteins?

While TP_1037 shares the general characteristics of bacterial membrane proteins, it has distinct structural features compared to other T. pallidum membrane components. Unlike the well-characterized BamA protein (involved in outer membrane protein assembly) that has been targeted in GFP expression studies, TP_1037 lacks the POTRA domains characteristic of BamA. Functionally, TP_1037 may participate in different membrane-associated processes than other characterized proteins like TprK (antigenic variation) or Tp0751 (adhesion).

Current research using GFP-tagged treponemal proteins demonstrates the emerging ability to study membrane protein localization and function in situ. The functional significance of TP_1037 remains under investigation, with potential roles in nutrient acquisition, membrane stability, or immune evasion. Comparative studies with other membrane proteins could reveal unique structural adaptations that contribute to T. pallidum's remarkable parasitic lifestyle and immune evasion capabilities .

What expression systems are optimal for producing functional recombinant TP_1037?

E. coli expression systems have been successfully employed for recombinant production of TP_1037. The protein has been expressed as a full-length construct (amino acids 1-238) with an N-terminal His-tag to facilitate purification. For membrane proteins like TP_1037, expression optimization typically requires:

  • Selection of appropriate E. coli strains (e.g., BL21(DE3), C41/C43) that better tolerate membrane protein expression

  • Temperature optimization (often lower temperatures of 16-25°C reduce inclusion body formation)

  • Induction parameters adjustment (IPTG concentration, induction timing)

  • Consideration of solubilization approaches using detergents

The resulting recombinant protein can be lyophilized for storage stability. Reconstitution protocols typically recommend using deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL, with glycerol addition (5-50% final concentration) for long-term storage at -20°C or -80°C .

How should experimental designs be structured when studying TP_1037 functional properties?

When designing experiments to investigate TP_1037 functions, researchers should employ systematic approaches that control for variables affecting membrane protein behavior. A comprehensive experimental design should:

  • Clearly define independent variables (e.g., protein concentration, buffer conditions, interaction partners) and dependent variables (e.g., binding affinity, conformational changes, transport activity)

  • Include appropriate controls:

    • Negative controls (e.g., buffer-only, irrelevant membrane proteins)

    • Positive controls (e.g., known interacting partners)

    • Technical replicates to assess reproducibility

    • Biological replicates to account for variation

  • Implement factorial designs when testing multiple variables to identify potential interactions between factors

  • Consider dose-response relationships when measuring interactions with potential binding partners or inhibitors

Researchers should systematically manipulate experimental conditions while controlling for extraneous variables that might confound results. For membrane proteins like TP_1037, special attention should be paid to detergent conditions, lipid composition, and buffer systems that can dramatically influence protein behavior and interactions .

What methodological approaches are most effective for studying TP_1037 localization and interactions within bacterial membranes?

Recent advances in T. pallidum research have enabled more sophisticated approaches to membrane protein localization studies. The following methodologies are particularly valuable:

  • Fluorescent protein tagging: The development of GFP-expressing T. pallidum strains provides a powerful approach for visualizing membrane protein localization. By creating fluorescent fusion constructs with TP_1037, researchers can observe its distribution in live bacteria. This technique has successfully been applied to other treponemal proteins, confirming the feasibility of this approach for TP_1037 .

  • Immunolocalization with electron microscopy: Using antibodies specifically targeting TP_1037, researchers can precisely localize the protein within bacterial ultrastructure, determining whether it associates with the inner or outer membrane.

  • Fractionation analyses: Differential detergent solubilization and gradient centrifugation techniques can separate membrane fractions and identify TP_1037's native membrane association.

  • Co-immunoprecipitation combined with proteomics: This approach can identify interaction partners of TP_1037, providing insights into potential functional complexes.

  • Flow cytometry for surface exposure assessment: If TP_1037 has externally exposed domains, fluorescent antibody labeling coupled with flow cytometry can quantify surface exposure under different conditions .

Each method provides complementary information, and combining approaches yields the most comprehensive understanding of TP_1037's membrane biology.

How can researchers effectively analyze antibody responses against TP_1037 in the context of syphilis immunopathogenesis?

To analyze antibody responses against TP_1037 and understand their role in syphilis immunopathogenesis, researchers should implement a multi-faceted experimental approach:

  • Flow cytometric membrane integrity assays: Following the methodology established for GFP-expressing T. pallidum, researchers can assess antibody-mediated damage to the spirochete's outer membrane. This approach enables quantification of both growth inhibition and membrane disruption in a dose-dependent manner .

  • Strain comparative immunology: Comparing antibody effectiveness across different T. pallidum strains (e.g., Nichols vs. SS14) can reveal strain-specific variations in antibody recognition and protection. This is particularly important as greater outer membrane disruption has been observed with homologous strain antibodies compared to heterologous ones .

  • Opsonophagocytosis assays: Using bone marrow-derived macrophages, researchers can assess the ability of anti-TP_1037 antibodies to promote phagocytosis of T. pallidum, providing insights into potential clearance mechanisms. Fluorescent bacterial strains facilitate direct visualization of this process .

  • Epitope mapping: Identifying specific epitopes recognized by protective antibodies can guide vaccine design efforts.

  • Time-course analyses: Tracking antibody development against TP_1037 throughout infection progression can correlate antibody emergence with disease clearance phases.

This comprehensive approach can determine whether TP_1037 represents a viable target for diagnostic or vaccine development efforts in syphilis research.

What controls and validation steps are necessary when using recombinant TP_1037 in experimental systems?

When working with recombinant TP_1037, implementing appropriate controls and validation steps is essential for generating reliable data:

  • Protein quality controls:

    • SDS-PAGE analysis to confirm >90% purity

    • Western blotting to verify His-tag accessibility

    • Mass spectrometry to confirm protein identity

    • Circular dichroism to assess secondary structure

    • Size exclusion chromatography to evaluate oligomeric state

  • Functional validation:

    • Comparative analysis with native TP_1037 (if accessible)

    • Verification of membrane association in reconstituted systems

    • Assessment of proper folding through conformation-specific antibodies

  • Experimental controls:

    • Denatured protein controls to distinguish specific from non-specific effects

    • Irrelevant membrane proteins of similar size/structure as negative controls

    • Concentration gradients to establish dose-dependency

    • Vehicle controls to account for buffer/storage solution effects

  • Storage stability assessment:

    • Testing activity after various freeze-thaw cycles

    • Comparing fresh vs. stored protein performance

    • Monitoring for degradation during experimental timeframes

Proper documentation of these validation steps significantly increases data reliability and reproducibility in TP_1037 research.

How can fluorescent TP_1037 constructs advance understanding of Treponema pallidum pathogenesis?

Developing fluorescent TP_1037 constructs represents a cutting-edge approach for investigating T. pallidum pathogenesis. Based on recent innovations with GFP-expressing T. pallidum, several applications for fluorescent TP_1037 constructs could significantly advance the field:

  • Real-time tracking of protein dynamics: Fluorescent TP_1037 would enable visualization of protein redistribution during different phases of the bacterial life cycle and upon host cell contact.

  • Host-pathogen interaction studies: Researchers could directly observe TP_1037's role during spirochete interaction with host cells during co-cultivation in vitro, providing insights into attachment mechanisms and cellular invasion processes.

  • Tissue tropism investigations: Following the methodology established with GFP-expressing T. pallidum in rabbit models, fluorescent TP_1037 would allow visualization of protein expression and localization in various infected tissues, potentially explaining tissue-specific manifestations of syphilis .

  • Immune response visualization: Combining fluorescent TP_1037 with immune cell markers would enable direct observation of immune recognition events, including opsonophagocytosis by bone marrow-derived macrophages .

  • Therapeutic intervention assessment: Fluorescent constructs facilitate high-throughput screening approaches to identify molecules that disrupt TP_1037 function or localization.

These applications could transform understanding of how specific membrane proteins contribute to the remarkable invasiveness and immune evasion capabilities of T. pallidum.

What are the latest findings regarding TP_1037's role in Treponema pallidum's outer membrane integrity and immune evasion?

While direct studies specifically targeting TP_1037's role in membrane integrity are still emerging, significant insights can be drawn from related research on T. pallidum membrane biology:

Recent studies using GFP-expressing T. pallidum have demonstrated the critical importance of outer membrane integrity for spirochete survival. Flow cytometric analysis has revealed that antibody-mediated disruption of the outer membrane represents a key mechanism for clearing treponemal infection. This approach has shown dose-dependent growth inhibition and membrane disruption in vitro when spirochetes are exposed to immune sera .

Particularly relevant is the observation that strain-specific antibody responses show differential effectiveness, with sera from Nichols strain-infected rabbits causing greater membrane disruption than sera from rabbits infected with the genetically distinct SS14 strain. This finding highlights the importance of outer membrane protein-specific antibody responses in the clearance of T. pallidum during infection .

As a membrane protein, TP_1037 may contribute to this strain-specific recognition pattern. Its potential role in maintaining membrane structural integrity or participating in antigenic variation mechanisms remains an active area of investigation. Understanding TP_1037's contributions to membrane biology could reveal new targets for therapeutic intervention in syphilis.

How can contradictions in experimental data regarding TP_1037 function be reconciled through improved methodological approaches?

When faced with contradictory data regarding TP_1037 function, researchers should implement a systematic approach to reconciliation:

  • Standardize experimental conditions:

    • Establish uniform protein preparation protocols to eliminate variation in protein quality

    • Standardize buffer systems, particularly detergent types and concentrations

    • Control environmental factors (temperature, pH, ionic strength)

  • Implement factorial experimental designs:

    • Systematically manipulate multiple variables to identify interaction effects

    • Test hypotheses under diverse conditions to determine context-dependent behaviors

    • Use statistical approaches to quantify variable contributions to observed outcomes

  • Develop quantitative assays with internal controls:

    • Replace qualitative observations with quantifiable metrics

    • Include internal calibration standards in each experiment

    • Employ ratiometric measurements to reduce instrument-based variability

  • Integrate multiple methodologies:

    • Combine biophysical, biochemical, and cellular approaches

    • Verify findings across different experimental systems

    • Bridge in vitro observations with in vivo validation

  • Consider genetic diversity impacts:

    • Evaluate TP_1037 sequence variation across T. pallidum strains

    • Assess functional consequences of polymorphisms

    • Relate strain-specific behaviors to clinical outcomes

This structured approach can transform contradictory results into a more nuanced understanding of context-dependent protein functions.

What strategies can enhance the stability and functionality of recombinant TP_1037 for structural studies?

Obtaining stable, functional recombinant TP_1037 for structural studies presents significant challenges typical of membrane proteins. The following strategies can enhance success:

  • Expression system optimization:

    • Test multiple expression vectors with different promoter strengths

    • Evaluate various E. coli strains specialized for membrane protein expression

    • Consider eukaryotic expression systems for complex membrane proteins

    • Optimize induction conditions (temperature, inducer concentration, duration)

  • Protein engineering approaches:

    • Design constructs with removable fusion partners (e.g., MBP, SUMO) to enhance solubility

    • Test different tag positions (N-terminal vs. C-terminal)

    • Consider truncation constructs focusing on stable domains

    • Introduce stability-enhancing mutations based on computational prediction

  • Purification refinement:

    • Screen detergent panels to identify optimal solubilization conditions

    • Implement multistep purification protocols to achieve >90% purity

    • Utilize size exclusion chromatography as a final polishing step

    • Verify monodispersity through dynamic light scattering

  • Stabilization strategies:

    • Test lipid nanodisc incorporation for native-like membrane environment

    • Evaluate amphipol stabilization for cryo-EM studies

    • Consider antibody fragment co-crystallization to stabilize flexible regions

    • Implement thermal shift assays to identify stabilizing buffer conditions

  • Storage optimization:

    • Utilize trehalose as a stabilizing excipient (6% in Tris/PBS-based buffer)

    • Aliquot to avoid repeated freeze-thaw cycles

    • Store at -80°C for long-term stability

    • Validate activity retention after storage

These approaches significantly increase the likelihood of obtaining structural-quality protein preparations suitable for crystallography, cryo-EM, or NMR studies.

How should researchers analyze flow cytometry data to assess antibody-mediated damage to TP_1037 in the bacterial membrane?

Analysis of flow cytometry data for assessing antibody-mediated damage to membrane proteins like TP_1037 requires rigorous methodological approaches:

  • Gating strategy development:

    • Establish forward/side scatter gates to identify intact spirochetes

    • Use fluorescence intensity thresholds to distinguish GFP-positive from negative populations

    • Implement time gates to ensure stable sample flow

    • Create quadrant or multiple gates to categorize membrane integrity states

  • Controls for accurate interpretation:

    • Include untreated spirochetes as negative controls

    • Use known membrane-disrupting agents (e.g., detergents) as positive controls

    • Include isotype control antibodies to establish baseline non-specific binding

    • Employ single-color controls for compensation when using multiple fluorophores

  • Quantitative analysis approaches:

    • Calculate percent reduction in GFP-positive population as indicator of membrane disruption

    • Measure dose-dependent effects across antibody dilution series

    • Determine EC50 values for comparative potency assessment between antibody sources

    • Analyze kinetics by measuring effects at multiple time points

  • Statistical validation:

    • Perform experiments in triplicate to enable statistical analysis

    • Apply appropriate statistical tests (t-tests, ANOVA) to determine significance

    • Account for biological variability across different bacterial preparations

    • Consider non-parametric tests for non-normally distributed data

This approach has successfully demonstrated that anti-T. pallidum Nichols strain antibodies cause greater outer membrane disruption than antibodies against the genetically distinct SS14 strain, highlighting the importance of strain-specific epitopes in membrane protein-targeted immune responses .

What data table formats most effectively communicate experimental results for TP_1037 research in grant applications?

For NIH and other grant applications, effectively formatted data tables significantly enhance the communication of TP_1037 research findings. Based on current NIH FORMS-I requirements, the following table structures are recommended :

Table 2: Antibody-Mediated Membrane Disruption Analysis

Antibody SourceDilutionGFP+ Cells (%)Membrane Integrity (%)Growth Inhibition (%)
Pre-immune Serum1:10095.3 ± 2.194.1 ± 3.25.2 ± 1.8
Anti-Nichols Strain1:10042.7 ± 5.338.5 ± 4.961.3 ± 6.2
Anti-Nichols Strain1:50068.2 ± 4.165.3 ± 5.333.8 ± 4.5
Anti-SS14 Strain1:10061.5 ± 4.857.2 ± 6.139.2 ± 5.7
Anti-SS14 Strain1:50079.8 ± 3.976.4 ± 4.222.4 ± 3.8

Table 3: TP_1037 Interaction Partners Identified by Co-Immunoprecipitation

ProteinAccessionMW (kDa)FunctionConfidence ScoreValidation Method
Protein 1TPXXXX45.2Membrane transport0.92Western blot
Protein 2TPXXXX32.8Cell division0.87ELISA
Protein 3TPXXXX28.3Unknown0.76Pending
Protein 4TPXXXX67.4Immune evasion0.89Co-localization

These table formats provide clear, comprehensive summaries of complex experimental data, facilitating reviewer understanding and demonstrating scientific rigor. When incorporated into grant applications, they should be accompanied by concise legends explaining experimental conditions and statistical analyses .

What bioinformatic approaches can predict TP_1037 structure-function relationships to guide experimental design?

Leveraging bioinformatic approaches to predict TP_1037 structure-function relationships can significantly enhance experimental design efficiency:

  • Sequence-based predictions:

    • Apply transmembrane helix prediction algorithms (TMHMM, Phobius) to identify membrane-spanning regions

    • Use SignalP to detect potential signal peptides

    • Identify conserved domains through PFAM and InterPro searches

    • Perform multiple sequence alignments across treponemal species to identify conserved residues

  • Structural modeling approaches:

    • Generate AlphaFold2 or RoseTTAFold predictions of TP_1037 structure

    • Refine models within simulated membrane environments using molecular dynamics

    • Identify potential ligand-binding pockets using CASTp or similar tools

    • Conduct electrostatic surface mapping to predict interaction interfaces

  • Functional annotation integration:

    • Correlate predicted structural features with metabolic pathway assignments

    • Map protein interaction network predictions onto structural models

    • Integrate transcriptomic data to identify co-expressed genes

    • Analyze synteny across bacterial species to infer functional relationships

  • Targeted mutation design:

    • Identify critical residues for mutagenesis based on conservation and structural position

    • Design structure-guided truncation constructs for domain function analysis

    • Create chimeric proteins to test domain-specific functions

    • Develop epitope mapping strategies based on predicted surface-exposed regions

These computational predictions can guide experimental priorities, focusing laboratory efforts on the most promising hypotheses regarding TP_1037's structural organization and functional roles in treponemal biology.

How might TP_1037 research contribute to next-generation syphilis diagnostics?

Research on TP_1037 could significantly advance syphilis diagnostics through several innovative approaches:

  • Recombinant antigen-based serological tests:

    • Development of highly specific ELISAs using recombinant TP_1037

    • Creation of multiplex assays combining TP_1037 with other treponemal antigens

    • Design of lateral flow devices for point-of-care testing

    • Implementation of quantitative assays that might correlate with disease stage

  • Molecular diagnostic applications:

    • Design of specific primers targeting TP_1037 genetic variants

    • Development of CRISPR-based detection systems for highly sensitive DNA detection

    • Creation of mRNA detection methods to identify actively replicating organisms

    • Implementation of digital PCR approaches for absolute quantification

  • Advanced imaging diagnostics:

    • Generation of TP_1037-specific aptamers for in vivo imaging

    • Development of antibody-based detection systems for tissue samples

    • Creation of fluorescent probes targeting TP_1037 for microscopy applications

    • Implementation of multiplexed imaging platforms for comprehensive pathogen detection

  • Next-generation biomarker applications:

    • Identification of TP_1037 peptide fragments in patient samples as disease indicators

    • Development of antibody profiling to distinguish active from past infection

    • Creation of assays measuring anti-TP_1037 antibody avidity to determine infection timing

    • Implementation of mass spectrometry approaches for protein variant detection

These diagnostic approaches could address critical needs in syphilis management, including distinguishing active from treated infection, early detection, and monitoring treatment response—challenges not fully resolved by current diagnostic methods.

What experimental approaches would best elucidate TP_1037's potential role in antibiotic resistance mechanisms?

To investigate TP_1037's potential role in antibiotic resistance mechanisms, researchers should implement a comprehensive experimental strategy:

  • Comparative expression analysis:

    • Quantify TP_1037 expression levels before and after antibiotic exposure

    • Compare expression profiles between sensitive and resistant T. pallidum isolates

    • Analyze TP_1037 regulation in response to sub-inhibitory antibiotic concentrations

    • Conduct time-course studies to track expression changes during antibiotic adaptation

  • Genetic manipulation approaches:

    • Develop TP_1037 overexpression systems to assess resistance phenotypes

    • Create knock-down models using antisense RNA or CRISPR interference

    • Introduce site-directed mutations in potential functional domains

    • Complement T. pallidum mutants with variant TP_1037 alleles

  • Functional assays:

    • Assess membrane permeability changes associated with TP_1037 expression

    • Measure antibiotic accumulation in bacterial cells with modified TP_1037 levels

    • Determine minimum inhibitory concentrations in various genetic backgrounds

    • Evaluate biofilm formation capacity as a resistance mechanism

  • Structural biology approaches:

    • Characterize TP_1037-antibiotic interactions through binding assays

    • Perform co-crystallization studies with relevant antibiotics

    • Conduct molecular dynamics simulations of membrane properties

    • Map resistance-associated mutations onto structural models

  • Clinical correlation studies:

    • Sequence TP_1037 from treatment failure cases

    • Correlate specific variants with treatment outcomes

    • Develop predictive models for resistance based on genetic markers

    • Test experimental findings against clinical isolate behavior

This multifaceted approach would provide comprehensive insights into any role TP_1037 might play in the emerging concern of antibiotic resistance in T. pallidum infections.

How can systems biology approaches integrate TP_1037 research into broader understanding of Treponema pallidum pathogenesis?

Integrating TP_1037 research into systems biology frameworks offers transformative potential for understanding T. pallidum pathogenesis:

  • Multi-omics data integration:

    • Correlate TP_1037 expression with global transcriptomic profiles

    • Map proteomic interaction networks centered on TP_1037

    • Integrate metabolomic changes associated with TP_1037 perturbation

    • Analyze epigenetic regulation patterns affecting TP_1037 expression

  • Network analysis approaches:

    • Construct protein-protein interaction networks including TP_1037

    • Identify regulatory modules controlling TP_1037 and related proteins

    • Map TP_1037 to functional pathways using KEGG or BioCyc resources

    • Perform centrality analysis to determine TP_1037's network importance

  • Host-pathogen interface modeling:

    • Incorporate TP_1037 data into agent-based models of infection

    • Simulate immune response dynamics to TP_1037 epitopes

    • Model tissue-specific interactions based on TP_1037 expression patterns

    • Predict infection outcomes using machine learning integration of multiple data types

  • Comparative systems approaches:

    • Analyze TP_1037 homologs across pathogenic and non-pathogenic treponemes

    • Compare network positioning in different bacterial species

    • Conduct evolutionary analysis of system-level adaptations

    • Identify conserved system motifs across spirochetal pathogens

  • Translational integration:

    • Connect systems-level insights to clinical phenotypes

    • Identify potential diagnostic biomarkers from integrated analysis

    • Discover therapeutic targets within TP_1037-associated pathways

    • Develop predictive models for treatment response

This systems biology framework would position TP_1037 research within the broader context of treponemal pathogenesis, potentially revealing emergent properties not apparent from reductionist approaches.

What are the most significant knowledge gaps in current TP_1037 research that future studies should address?

Despite recent advances in T. pallidum research, significant knowledge gaps regarding TP_1037 persist. Future studies should prioritize:

  • Functional characterization: Definitively establishing TP_1037's biological role through targeted gene modulation and functional assays. This requires expanding on the recent advances in genetic manipulation techniques demonstrated with GFP-expressing T. pallidum .

  • Structural determination: Obtaining high-resolution structural data through X-ray crystallography, cryo-EM, or NMR to inform function prediction and drug design. The current availability of recombinant expression systems provides a starting point for these studies .

  • Immunological significance: Determining whether TP_1037 represents a significant target for protective immunity, building on recent findings regarding strain-specific antibody effectiveness against treponemal outer membrane proteins .

  • Clinical correlations: Establishing relationships between TP_1037 variants and clinical presentations or treatment outcomes in diverse patient populations.

  • Systems-level integration: Positioning TP_1037 within broader molecular networks to understand its contributions to T. pallidum's remarkable pathogenic properties.

Addressing these knowledge gaps would significantly advance understanding of this important membrane protein and potentially open new avenues for diagnostic and therapeutic development in syphilis management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.