Recombinant Treponema pallidum V-type ATP synthase subunit I 2 (atpI2)

Shipped with Ice Packs
In Stock

Description

Functional Role in T. pallidum Physiology

The ATP synthase complex in T. pallidum was initially classified as V-type but is now considered an A-type ATP synthase based on phylogenetic analyses . This enzyme likely couples proton motive force to ATP synthesis, a critical adaptation for survival in energy-limited host environments. Key findings:

  • Energy Conservation: Proposed to work with a flavin-dependent Rnf redox system to maintain electrochemical gradients, enabling ATP synthesis despite the bacterium’s reliance on glycolysis .

  • Structural Dynamics: Exhibits conformational changes for lipid interaction and membrane integration, suggesting roles in membrane biogenesis .

Diagnostic Applications

Recombinant atpI2 is used in ELISA-based serological tests for syphilis detection:

  • ELISA Kits: Commercial assays (e.g., CBM15’s product) utilize recombinant atpI2 to detect anti-T. pallidum antibodies with high specificity .

  • Performance Metrics: While not as widely adopted as TpN17 or TpN47, atpI2 contributes to antigen panels improving diagnostic sensitivity when combined with other immunogenic proteins like TmpA .

Technical Limitations

  • Low abundance in T. pallidum proteome complicates native protein isolation, necessitating recombinant production for functional studies .

  • Structural homology to human ATP synthases raises challenges for specificity in antibody-based assays .

Future Directions

  • Mechanistic Studies: Clarify atpI2’s role in ATP synthesis and its interaction with the Rnf redox system .

  • Diagnostic Optimization: Evaluate atpI2 in multi-antigen assays to enhance sensitivity for early/latent syphilis .

  • Therapeutic Exploration: Test recombinant atpI2 in vaccine formulations to assess immunogenicity and protective efficacy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
atpI2; TP_0533; V-type ATP synthase subunit I 2; V-ATPase subunit I 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-454
Protein Length
full length protein
Species
Treponema pallidum (strain Nichols)
Target Names
atpI2
Target Protein Sequence
MFRSQRMKFLELVVLERDVDRVLEYLGKTALVHLRLSAAARGSSSHCAQSKEYVGRLEEA CKYLGVSGECAFSPGDSLPTEEDYTLAQQILAEVDALHAREREGDAPSVPRGKSSVAHDS ANEEQFQGEKCALGSMRGPALCALLRRFALQERVHRTRDALESTRHTYRIAGWLPAHEAK DLVAGLDNVTTGRMAVRLFEPQELSFIRDGSEHVPVCYQHGRFVRSYERMVSSYGCPPYG LVDPTPFVAFSYALLFGIMFGDLGQGLLFFVLGLLLRTRRVRALNRWAHLDYVFLSVGFS SMVMGFLTGEFFAHGTLLAPLIRSVTALCGGVPRDHILHLMPSHGSLHTLMAFFGFTLFL GFVINSLGLIINIVNQVRLRHALQQCVQKRECADSSFFGTWLPLQCAYHFLEFHSGSLMR LQWACLSWVFFVKSFWSVCASVCVRGFLKVLACI
Uniprot No.

Target Background

Function
Produces ATP from ADP in the presence of a transmembrane proton gradient.
Database Links

KEGG: tpa:TP_0533

STRING: 243276.TP0533

Protein Families
V-ATPase 116 kDa subunit family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Treponema pallidum V-type ATP synthase subunit I 2 (atpI2)?

Treponema pallidum V-type ATP synthase subunit I 2 (atpI2) is a protein encoded by the atpI2 gene (TP_0533) in Treponema pallidum. It functions as a component of the V-type ATP synthase complex, which is crucial for energy metabolism in this pathogenic bacterium. The protein is also known as V-ATPase subunit I 2 and has a UniProt ID of O83544. In its recombinant form, it is typically expressed as a full-length protein consisting of 454 amino acids, often with tags (such as His-tag) to facilitate purification and experimental applications. The protein plays a significant role in the bioenergetics of Treponema pallidum, contributing to its survival and pathogenicity .

What expression systems are recommended for producing recombinant atpI2?

Escherichia coli (E. coli) is the most validated and recommended expression system for producing recombinant Treponema pallidum atpI2 protein. Commercial preparations typically use E. coli as the host organism, with the addition of an N-terminal His-tag to facilitate purification using affinity chromatography. This expression system has been optimized to provide high yields of functional protein while maintaining the native structure of atpI2. When designing expression constructs, researchers should consider codon optimization for E. coli to improve translation efficiency, as the GC content and codon usage of Treponema pallidum differ significantly from those of E. coli .

The expression and purification protocol should include rigorous quality control measures, including SDS-PAGE analysis to confirm purity (typically >90%) and proper folding assessment to ensure biological activity is preserved. Alternative expression systems such as insect cells or mammalian cells may be considered for specific applications requiring eukaryotic post-translational modifications, though these are less commonly used for this bacterial protein .

What are the optimal storage conditions for recombinant atpI2?

Recombinant Treponema pallidum V-type ATP synthase subunit I 2 is typically supplied as a lyophilized powder and requires specific storage conditions to maintain stability and activity. The recommended storage protocol is:

Storage StageRecommended ConditionsDuration
Long-term storage-20°C to -80°CUp to 2 years
Working aliquots4°CUp to one week
Reconstituted protein-20°C with 50% glycerol6-12 months

It is critically important to avoid repeated freeze-thaw cycles as they significantly degrade protein quality. For optimal preservation, the recombinant protein should be aliquoted after reconstitution to minimize the number of freeze-thaw events. Commercial preparations are typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which enhances stability during lyophilization and storage .

What methodology should be followed for reconstituting lyophilized atpI2?

The reconstitution process for lyophilized atpI2 requires careful attention to preserve protein integrity and activity. The recommended methodology involves:

  • Briefly centrifuge the vial containing lyophilized protein prior to opening to bring all contents to the bottom of the tube.

  • Reconstitute the protein in deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% to prevent freeze damage during subsequent storage (50% glycerol is commonly used as the standard concentration).

  • Gently mix the solution by inversion rather than vortexing to prevent protein denaturation.

  • Aliquot the reconstituted protein into volumes appropriate for single-use experiments to avoid repeated freeze-thaw cycles.

This methodological approach ensures maximum retention of protein activity while minimizing degradation. It is advisable to perform activity testing after reconstitution to confirm that the protein has maintained its structural and functional integrity .

How can recombinant atpI2 be used in Treponema pallidum growth and virulence studies?

Recombinant atpI2 can serve as a valuable tool in studying Treponema pallidum growth dynamics and virulence mechanisms through several methodological approaches:

  • Comparative Growth Analysis: Researchers can use purified recombinant atpI2 to develop antibodies for tracking native protein expression levels in different Treponema pallidum strains. Studies have demonstrated that strains like DAL-1 (belonging to the Nichols-like group) exhibit differential growth rates, growing approximately 1.53 (± 0.08) times faster than other strains. This suggests potential differences in energy metabolism efficiency that may be correlated with atpI2 function .

  • In Vitro Culture Systems: When establishing in vitro cultures for studying atpI2 function, researchers typically use a standardized methodology involving:

    • Inoculation of precisely counted treponemes (250,000 bacterial cells)

    • Co-cultivation with rabbit Sf1EP cells (10,000 cells) in TpCM-2 medium

    • Maintenance in a low-oxygen atmosphere (2.5%)

    • Incubation for seven days before assessment

    • Collection using Trypsin/EDTA solution

    • Quantification through both dark-field microscopy and qPCR analysis

  • Gene Knockdown/Overexpression Studies: Recombinant atpI2 can be used as a control in experiments where the native gene is manipulated to assess the protein's contribution to energy metabolism and bacterial survival.

This systematic approach allows researchers to correlate atpI2 expression and function with treponemal growth characteristics and pathogenic potential .

What are the established methods for quantifying atpI2 expression in experimental settings?

Quantification of atpI2 expression in experimental settings employs multiple complementary methodologies for comprehensive analysis:

  • Quantitative PCR (qPCR): This is the gold standard for gene expression quantification. For atpI2, researchers typically:

    • Extract total RNA or DNA from treponemes collected from in vitro cultures or infected tissues

    • Perform qPCR using atpI2-specific primers

    • Normalize expression against housekeeping genes

    • Calculate relative expression using the 2^(-ΔΔCt) method

  • Immunodetection Methods:

    • Western blot analysis using antibodies raised against recombinant atpI2

    • Immunofluorescence microscopy for localization studies

    • ELISA-based quantification of protein levels in cell lysates

  • Functional Assays:

    • ATP synthesis activity measurements using purified membrane fractions

    • Proton transport assays to assess V-ATPase function

When designing experiments involving atpI2 quantification, researchers should include appropriate controls and perform biological replicates (n ≥ 4) with multiple technical replicates to ensure statistical robustness of the findings .

How does atpI2 function differ between Treponema pallidum strains and what are the implications for pathogenicity?

Research indicates significant functional differences in atpI2 between Treponema pallidum strains, with important implications for pathogenicity. Studies comparing the DAL-1 strain (Nichols-like group) with other strains have demonstrated a 1.53 (± 0.08) times faster growth rate for DAL-1. This growth advantage suggests potential differences in energy metabolism efficiency that may be attributed to variations in V-type ATP synthase functionality .

The methodological approach to investigating these differences typically involves:

  • Comparative Genomic Analysis: Examining sequence variations in the atpI2 gene (TP_0533) across different Treponema pallidum strains to identify potential functional mutations.

  • Growth Kinetics Assessment: Using standardized in vitro co-cultivation systems with rabbit cells to quantify growth rates between strains under identical conditions.

  • Protein Activity Measurements: Comparing ATP synthesis and proton transport activities of membrane fractions isolated from different strains.

  • In Vivo Virulence Studies: Intratesticular co-infection experiments in laboratory rabbits to correlate atpI2 function with pathogenicity.

StrainGrowth Rate Relative to ReferenceCommon Mutations in atpI2Pathogenicity in Animal Models
DAL-1 (Nichols-like)1.53 ± 0.08Reference sequenceHigh
Philadelphia 11.00 (reference)Variations may occurVariable

These findings suggest that atpI2 may serve as one of the molecular determinants of strain-specific virulence and tissue tropism in Treponema pallidum infections. The energy metabolism advantages conferred by variant forms of atpI2 could contribute to enhanced bacterial survival in host environments and increased pathogenic potential .

What structural and functional characteristics distinguish V-type ATP synthase subunit I 2 in Treponema pallidum from other bacterial species?

The V-type ATP synthase subunit I 2 (atpI2) in Treponema pallidum possesses several distinctive structural and functional characteristics compared to similar proteins in other bacterial species:

  • Structural Analysis: The 454-amino acid sequence of Treponema pallidum atpI2 contains distinctive transmembrane domains and functional motifs. Computational structural analysis predicts:

    • Multiple transmembrane helices creating a proton channel

    • Hydrophobic regions (e.g., "LLFFVLGLLLRTRRVRALNR") that facilitate membrane integration

    • Conserved functional domains involved in proton translocation

    • Species-specific regions that may confer unique regulatory properties

  • Functional Specialization: Unlike many bacteria that primarily utilize F-type ATP synthases, Treponema pallidum relies heavily on V-type ATP synthases for energy generation. This adaptation may reflect the unique energy requirements of this obligate human pathogen with its microaerophilic lifestyle.

  • Evolutionary Considerations: Phylogenetic analysis suggests that Treponema pallidum V-type ATP synthases share closer evolutionary relationships with archaeal and eukaryotic V-ATPases than with typical bacterial F-type ATP synthases, indicating potential horizontal gene transfer events in the evolutionary history of these spirochetes.

The methodological approach to investigating these distinctions typically combines computational analysis (sequence alignment, homology modeling), experimental structural biology (X-ray crystallography, cryo-EM), and functional enzymatic assays to comprehensively characterize the unique properties of this protein .

What experimental systems are most effective for studying atpI2 function in the context of Treponema pallidum metabolism?

The study of atpI2 function in Treponema pallidum metabolism presents unique challenges due to the organism's fastidious growth requirements and limited genetic manipulation tools. Several experimental systems have been developed to overcome these limitations:

  • Co-cultivation Systems: The most established methodology involves:

    • Co-cultivation of treponemes (standardized at 250,000 cells) with rabbit Sf1EP cells (10,000 cells)

    • Maintenance in TpCM-2 medium (1.5 ml final volume)

    • Incubation for seven days in a low-oxygen atmosphere (2.5%)

    • Collection using Trypsin/EDTA solution

    • Assessment via dark-field microscopy and qPCR

  • In Vivo Animal Models: While technically challenging, these provide valuable insights into atpI2 function in a physiologically relevant context:

    • Intratesticular infection in rabbits with defined inoculation doses

    • Extraction of treponemes from infected tissues

    • Comparative growth analysis between different strains

    • Correlation of growth characteristics with atpI2 expression levels

  • Recombinant Protein Functional Assays: Using purified recombinant atpI2:

    • Reconstitution into liposomes or nanodiscs

    • Measurement of ATP synthesis or hydrolysis activities

    • Assessment of proton translocation efficiency

    • Evaluation of inhibitor sensitivity

  • Heterologous Expression Systems: Expression of Treponema pallidum atpI2 in genetically tractable bacteria (e.g., E. coli) with ATP synthase mutations to assess functional complementation.

Each experimental system offers distinct advantages, and the integration of multiple approaches provides the most comprehensive understanding of atpI2's role in treponemal metabolism. Researchers should carefully select systems based on their specific research questions and available resources .

How might atpI2 serve as a target for novel therapeutic approaches against treponemal infections?

Given its critical role in energy metabolism, atpI2 represents a promising target for developing novel therapeutic strategies against Treponema pallidum infections. Several methodological approaches warrant exploration:

  • Structure-Based Drug Design: Using the recombinant protein for:

    • High-resolution structural determination via X-ray crystallography or cryo-EM

    • In silico screening of small molecule libraries targeting atpI2-specific pockets

    • Rational design of inhibitors that selectively disrupt V-type ATP synthase function

    • Optimization of lead compounds for enhanced specificity and reduced host toxicity

  • Immunotherapeutic Approaches: Leveraging recombinant atpI2 for:

    • Development of subunit vaccines targeting exposed epitopes

    • Generation of therapeutic antibodies that interfere with ATP synthase assembly

    • Design of immunomodulatory strategies that enhance host recognition of infected cells

  • Combination Therapy Strategies: Investigating synergistic effects between:

    • ATP synthase inhibitors and existing antibiotics

    • Metabolic pathway modulators that increase bacterial dependency on ATP synthesis

    • Host-directed therapies that alter the microenvironment to further stress bacterial metabolism

The methodological framework for these investigations should include initial in vitro screening, followed by validation in co-cultivation systems, and ultimately testing in animal models of treponemal infection. Given the observed growth rate differences between Treponema pallidum strains (e.g., DAL-1 growing 1.53 times faster than other strains), therapeutic strategies may need to account for strain-specific variations in atpI2 function and expression .

What techniques are emerging for the manipulation of atpI2 expression to better understand its role in Treponema pallidum physiology?

Despite the historical challenges in genetically manipulating Treponema pallidum, several emerging techniques show promise for investigating atpI2 function through controlled expression manipulation:

  • Conditional Expression Systems:

    • Development of inducible promoters functional in Treponema pallidum

    • Adaptation of tetracycline-responsive elements for controlled gene expression

    • Application of riboswitch technology to regulate atpI2 translation

  • RNA-Based Approaches:

    • Design of antisense oligonucleotides targeting atpI2 mRNA

    • Application of CRISPR interference (CRISPRi) for gene silencing

    • Development of RNA aptamers that modulate protein function

  • Protein-Level Manipulation:

    • Creation of destabilization domains fused to atpI2 for controlled protein degradation

    • Application of engineered proteases for targeted protein cleavage

    • Development of conformation-specific intrabodies

  • Synthetic Biology Approaches:

    • Construction of minimal Treponema pallidum metabolic networks in heterologous hosts

    • Creation of synthetic gene circuits to probe atpI2 regulatory networks

    • Development of cell-free expression systems using treponemal components

These emerging methodologies, while technically challenging, offer unprecedented opportunities to dissect the precise contribution of atpI2 to Treponema pallidum physiology. Their successful implementation will require interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and computational modeling .

What controls should be included when using recombinant atpI2 in experimental protocols?

When designing experiments involving recombinant Treponema pallidum V-type ATP synthase subunit I 2, a comprehensive set of controls should be included to ensure robust and interpretable results:

  • Protein Quality Controls:

    • Purity assessment via SDS-PAGE (should exceed 90%)

    • Western blot confirmation of identity using anti-His tag and protein-specific antibodies

    • Circular dichroism analysis to confirm proper folding

    • Size exclusion chromatography to verify absence of aggregation

  • Functional Controls:

    • Heat-inactivated recombinant atpI2 as a negative control

    • Recombinant protein with site-directed mutations in catalytic residues

    • Related V-type ATP synthase subunits from different bacterial species for specificity testing

  • Experimental Controls for In Vitro Studies:

    • Vehicle-only treatments matching the buffer composition of the recombinant protein

    • Time-course analyses to establish optimal experimental endpoints

    • Concentration-response relationships to determine effective dose ranges

  • Controls for In Vivo Experiments:

    • Sham-inoculated animals receiving buffer only

    • Animals receiving irrelevant proteins of similar size and preparation

    • Time-matched controls to account for natural disease progression

When conducting co-cultivation experiments with treponemes and rabbit cells, standardization of inoculum (250,000 treponemal cells with 10,000 rabbit Sf1EP cells) is essential for reproducible results. Each biological experiment should include at least four technical replicates to account for inherent variability in biological systems .

How can researchers address challenges in comparing data across different experimental systems studying atpI2?

Comparing data across different experimental systems studying Treponema pallidum atpI2 presents significant challenges due to variations in methodologies, reagents, and analytical approaches. A systematic framework for addressing these challenges includes:

  • Standardization of Key Parameters:

    • Use recombinant atpI2 from validated sources with documented purity (>90% by SDS-PAGE)

    • Implement uniform storage conditions (-20°C/-80°C for long-term; 4°C for working aliquots up to one week)

    • Adopt standardized reconstitution protocols (sterile water to 0.1-1.0 mg/mL with 5-50% glycerol)

    • Establish consistent cell culture conditions (TpCM-2 medium, 2.5% oxygen atmosphere)

  • Development of Reference Standards:

    • Create centralized repositories of well-characterized strain isolates

    • Establish consensus positive and negative controls for functional assays

    • Develop quantitative reference materials for assay calibration

  • Data Normalization Approaches:

    • Utilize internal reference proteins or genes for relative quantification

    • Implement mathematical normalization models to account for systematic biases

    • Develop conversion factors for comparing across different quantification methods

  • Reporting Guidelines:

    • Document detailed methodological parameters beyond typical materials and methods sections

    • Report raw data alongside processed results to enable alternative analyses

    • Clearly describe statistical approaches and justifications for data transformations

By addressing these challenges systematically, researchers can enhance the comparability and reproducibility of atpI2 studies across different experimental platforms. This approach is particularly important when comparing strain-specific differences, such as the observed 1.53 (± 0.08) times faster growth rate of the DAL-1 strain compared to other Treponema pallidum strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.