Recombinant Trichodesmium erythraeum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction

Trichodesmium erythraeum is a filamentous cyanobacterium, notable for its ability to fix carbon and nitrogen in marine environments that have few nutrients . Apocytochrome f (petA) is a protein component of the cytochrome $$b_6f$$ complex found in the thylakoid membranes of cyanobacteria and chloroplasts . The cytochrome $$b_6f$$ complex mediates electron transfer between Photosystem II and Photosystem I in photosynthetic organisms. Recombinant Trichodesmium erythraeum Apocytochrome f (petA) refers to the protein that is produced using recombinant DNA technology, where the gene encoding Apocytochrome f from Trichodesmium erythraeum is expressed in a host organism to produce large quantities of the protein .

Applications of Recombinant petA

Recombinant Trichodesmium erythraeum Apocytochrome f (petA) has various applications:

  • Research: Useful in biochemical and biophysical studies to elucidate the structure, function, and interactions of the cytochrome $$b_6f$$ complex.

  • Antibody Production: Can be used to generate antibodies for detecting and quantifying Apocytochrome f in Trichodesmium erythraeum samples .

  • ELISA Assays: Employed as a standard in enzyme-linked immunosorbent assays (ELISA) for the quantitative determination of Apocytochrome f levels in biological samples .

Impact of Environmental Factors on Trichodesmium erythraeum

Trichodesmium erythraeum's growth and function are affected by environmental conditions such as iron and carbon dioxide (CO$$_2$$) concentrations . Higher CO$$_2$$ levels can increase growth rates across different iron concentrations and enable growth at lower iron concentrations . Iron limitation can impact the growth rate and photosynthetic electron transport rates, with high light intensities potentially increasing growth rates under these conditions . Aluminum (Al) fertilization may also impact carbon and nitrogen fixation in Trichodesmium erythraeum .

Methods for Studying Trichodesmium erythraeum Apocytochrome f (petA)

Table: Methods for Studying Trichodesmium erythraeum

MethodDescriptionApplication
MetagenomicsUtilizing metagenome-assembled genomes (MAGs) to assess the genetic diversity and distribution of Trichodesmium populations .Capturing the complex diversity of Trichodesmium and re-assessing its taxonomy .
Phylogenetic AnalysisExamining the evolutionary relationships of Trichodesmium species using marker genes such as hetR .Linking non-diazotrophic Trichodesmium species and understanding the diversity within populations .
Amplicon SequencingSequencing of specific genes like hetR to determine the abundance of different Trichodesmium species .Identifying and quantifying Trichodesmium species in environmental samples, although potential paralogs need consideration .
Physiological MeasurementsMeasuring growth rates, photosynthetic efficiency, and carbon/nitrogen fixation rates under various environmental conditions .Assessing the impact of factors like iron, CO$$_2$$, and aluminum on Trichodesmium physiology .
ELISA AssaysUsing recombinant Apocytochrome f (petA) as a standard in enzyme-linked immunosorbent assays .Quantifying Apocytochrome f levels in biological samples .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petA; Tery_1798; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
41-325
Protein Length
full length protein
Species
Trichodesmium erythraeum (strain IMS101)
Target Names
petA
Target Protein Sequence
YPFWAQETAPATPREATGRIVCANCHLGAKLTEVEVPQSVLPDTVFKAVVKIPYDTDVQQ VLGDGSKGGLNVGAVLMLPEGFKIAPEDRIPQEWQEELADLYFMPYSEEQENVLLFGPMP GDEYQEVVFPILSPDPATDKSIHFGKYAVHAGGNRGRGQVYPAGNKSNNTTYNVSASGKI TDITFEEYVGNQITIETPDSETVVDLVPPGPELLVAVGDTVEAGQVITNNPNVGGFGQAD TEIVLQDANRVKWLMAFFALVMLAQIMLVLKKKQVEKVQAAEMNF
Uniprot No.

Target Background

Function

Recombinant Trichodesmium erythraeum Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Database Links
Protein Families
Cytochrome f family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is apocytochrome f (petA) and what role does it play in Trichodesmium erythraeum?

Apocytochrome f is the protein product of the petA gene, a key component of the cytochrome b6f complex that mediates electron transport during photosynthesis. In T. erythraeum, this protein contributes to both linear and cyclic electron transport while facilitating proton pumping to create the electrochemical gradient necessary for ATP generation . The protein is particularly important in marine cyanobacteria like T. erythraeum that must optimize photosynthetic efficiency in oligotrophic environments. Unlike the apocytochrome (unassembled form), the mature cytochrome f contains a covalently attached heme group essential for its electron transfer function in photosynthesis.

How is the petA gene organized within the Trichodesmium erythraeum genome?

The petA gene is part of the core photosynthetic apparatus in the 7.75 Mbp genome of T. erythraeum . Unlike many typical bacterial genes, the genomic context of photosynthetic genes in T. erythraeum is characterized by the presence of numerous non-coding regions and regulatory elements. Only 60% of the T. erythraeum genome codes for proteins, compared to approximately 85% in other cyanobacterial genomes . This extensive non-coding fraction suggests the presence of complex regulatory mechanisms affecting the expression of photosynthetic genes including petA. Transcriptomic analysis has revealed transcriptional start sites (TSS) at single nucleotide resolution, demonstrating the activity of thousands of promoters across the genome that may influence petA expression .

What are the structural characteristics of apocytochrome f from Trichodesmium erythraeum?

T. erythraeum apocytochrome f maintains the conserved structural domains characteristic of cyanobacterial cytochrome f proteins, including:

DomainPositionFunctionConservation
N-terminal domainN-terminusHeme attachment site (CXXCH motif)Highly conserved
Large domainCentral regionElectron transfer interfaceModerately conserved
Small domainC-terminal regionMembrane anchoringModerately variable
Transmembrane helixC-terminusThylakoid membrane integrationConserved

The protein contains the characteristic CXXCH motif for covalent heme attachment, which distinguishes the mature cytochrome f from the apocytochrome form. Phylogenetic analysis indicates that T. erythraeum is closely related to other filamentous non-heterocystous species within the order Oscillatoriales , which likely influences some of the specific structural features of its apocytochrome f.

How does the expression of petA compare to other photosynthetic genes in Trichodesmium erythraeum?

The expression of photosynthetic genes in T. erythraeum, including petA, appears to be tightly regulated as part of the core photosynthetic apparatus. While the search results don't provide specific data on petA expression patterns, related cyanobacterial studies suggest that photosynthetic gene expression can be significantly affected by environmental conditions. For instance, in the related cyanobacterium Crocosphaera, ATP synthase gene expression was particularly lower under extreme conditions compared to other treatments, suggesting energy limitation during cellular decay . Cytochrome b6-f genes (which would include petA) showed similar expression levels between different treatments and time points, suggesting a more stable expression pattern than ATP synthase genes . This pattern of stable expression for electron transport components might be reflected in T. erythraeum as well.

What methodologies are most effective for expressing recombinant Trichodesmium erythraeum apocytochrome f?

Expressing functional recombinant apocytochrome f from T. erythraeum requires careful consideration of several factors:

Expression System Selection:

Expression SystemAdvantagesLimitationsRecommendations
E. coliHigh yield, rapid growth, well-established protocolsLacks post-translational modification machinery for heme attachmentSuitable for structural studies of apocytochrome (without heme)
Cyanobacterial hostsNative environment, proper folding and maturationLower yields, slower growth, more complex geneticsPreferred for functional studies requiring mature cytochrome f
Cell-free systemsAvoids toxicity issues, rapid productionLimited post-translational modifications, higher costUseful for preliminary expression testing

Optimization Strategies:

  • Codon optimization based on T. erythraeum's unusual genomic features (60% coding DNA)

  • Design of synthetic constructs that account for the high incidence of non-coding RNAs and regulatory elements

  • Temperature modulation during expression, considering T. erythraeum's tropical marine habitat

  • Co-expression with chaperones and cytochrome maturation proteins if using heterologous systems

For successful expression of functional protein with properly attached heme, heterologous expression in a cyanobacterial host closer to T. erythraeum, or co-expression with cytochrome c maturation (CCM) proteins in E. coli, may be necessary.

How can researchers address the unique splicing challenges when working with recombinant petA in Trichodesmium erythraeum?

T. erythraeum possesses an unusually high number of actively splicing group II introns, with at least 17 such introns identified in its genome . While the search results don't specifically mention introns in the petA gene, this genomic peculiarity must be considered when working with any T. erythraeum gene.

Recommended Approach for Addressing Splicing Challenges:

  • Transcript Analysis: Use dRNA-seq methodology as described for T. erythraeum to determine if petA contains introns requiring splicing

  • Detection Protocol:

    • Isolate total RNA following the protocol described in Sharma et al.

    • Treat RNA with Terminator-5′P-dependent-exonuclease (TEX)

    • Prepare cDNA libraries for both TEX-treated and untreated samples

    • Analyze using split-read mapping to identify potential splicing events (Fig. 5A in source)

  • Verification of Splicing:

    • Northern blot analysis to confirm the presence of splicing intermediates

    • RT-PCR across potential intron boundaries to detect mature mRNA

    • Comparison of genomic DNA and cDNA sequences

  • Expression Strategy:

    • If introns are present, consider using the cDNA sequence rather than genomic DNA for recombinant expression

    • Alternatively, ensure the expression host can properly process T. erythraeum group II introns

    • For heterologous expression, co-express splicing factors if necessary

The unique RNA maturation processes in T. erythraeum make it crucial to verify the correct transcript structure before designing expression constructs.

What are the implications of Trichodesmium erythraeum's Diversity Generating Retroelement (DGR) system for petA stability in recombinant expression?

The discovery of an active Diversity Generating Retroelement (DGR) in T. erythraeum has significant implications for genetic stability . This retroelement can potentially target multiple genes simultaneously, rewriting codons and altering carboxy-terminal amino acids in target proteins.

Analysis of DGR Impact on petA:

  • Assessment of petA as a Potential Target:

    • Examine the petA sequence for variable regions (VRs) matching the patterns identified in known DGR targets

    • Look for conserved adenosine positions that could be hotspots for mutagenesis

    • Check for proximity to template repeat (TR) sequences

  • Stability Considerations:

    • If petA contains potential VR regions, recombinant constructs may exhibit unexpected sequence variations

    • Document sequence variations by resequencing multiple clones

    • Consider potential functional implications of C-terminal amino acid variations

  • Mitigation Strategies:

    • Design recombinant constructs that exclude potential VR regions when possible

    • If VR regions are essential, implement sequence modifications that preserve amino acid sequence but alter nucleotide sequence to prevent targeting

    • Monitor sequence stability through multiple passages of expression strains

While the DGR system in laboratory cultures of T. erythraeum appears to be pseudogenized by a point mutation , the system remains active in wild populations. Researchers should be aware that genetic stability may differ between laboratory strains and natural isolates.

How do transcriptional regulatory elements unique to Trichodesmium erythraeum affect recombinant petA expression?

The transcriptome of T. erythraeum reveals an unusually complex regulatory landscape, with 6,080 identified transcriptional start sites (TSS) and a high proportion of non-coding RNAs . This complexity requires careful consideration when designing recombinant expression systems.

Key Regulatory Considerations:

  • Promoter Selection:

    • Determine the native TSS for petA using the comprehensive TSS map available (Supplementary Table S1)

    • Consider the strength of the native promoter based on TSS-associated primary read counts

    • Evaluate the 5'-untranslated region (5'UTR) structure, which may contain regulatory elements

  • Potential Regulatory Interference:

    • Check for antisense RNAs (asRNAs) that may regulate petA expression

    • Approximately 15% of all annotated genes in T. erythraeum have associated asRNAs

    • Determine if internal TSS (iTSS) exist within the petA gene that might generate regulatory transcripts

  • Optimization Strategy:

    • Include sufficient upstream sequence to capture all relevant regulatory elements

    • Consider the impact of genomic context when isolating the gene

    • Test multiple construct designs with varying amounts of native sequence context

Transcriptional Context Analysis Table:

Regulatory Element TypeFrequency in T. erythraeumPotential Impact on petADesign Consideration
gTSS (gene-associated)30% of all TSS Drives primary expressionInclude in expression constructs
nTSS (intergenic)26.8% of all TSS May affect upstream regulationConsider inclusion if proximal to petA
aTSS (antisense)14% of all TSS Could inhibit expressionCheck for presence and consider impact
iTSS (internal)Not specified in dataMay generate truncated productsIdentify and address in construct design

What protocols are recommended for isolating and purifying recombinant apocytochrome f from Trichodesmium erythraeum?

Purification of recombinant apocytochrome f requires specialized approaches due to its membrane association and heme cofactor:

Recommended Purification Protocol:

  • Cell Lysis and Membrane Fraction Isolation:

    • Harvest cells and resuspend in a buffer containing 10 mM sodium acetate, 200 mM D(+)-sucrose, 100 mM NaCl, 5 mM EDTA

    • Disrupt cells using sonication or French press

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization:

    • Solubilize membrane proteins using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration

    • Incubate with gentle agitation at 4°C for 1 hour

    • Clear insoluble material by centrifugation (20,000 × g for 30 minutes)

  • Affinity Purification:

    • For His-tagged constructs: Apply to Ni-NTA resin equilibrated with solubilization buffer containing 0.05% DDM

    • Wash with increasing imidazole concentrations (10-50 mM)

    • Elute with 250-300 mM imidazole

  • Additional Purification Steps:

    • Size exclusion chromatography using Superdex 200 column

    • Ion exchange chromatography as a polishing step

  • Quality Assessment:

    • UV-Visible spectroscopy to confirm heme incorporation (characteristic peaks at ~410 nm and ~550 nm)

    • SDS-PAGE with heme staining to distinguish between apocytochrome and holocytochrome forms

    • Mass spectrometry to confirm molecular weight and detect post-translational modifications

Expected Yield and Purity Metrics:

Expression SystemExpected Yield (mg/L culture)Typical PurityHeme Incorporation
E. coli5-15 (apoprotein)>90%Minimal unless co-expressed with CCM
Cyanobacterial hosts0.5-370-85%High (natural system)
Optimized E. coli + CCM2-8>85%Moderate to high

What analytical techniques are most appropriate for characterizing the structure and function of recombinant Trichodesmium erythraeum apocytochrome f?

Comprehensive characterization of recombinant apocytochrome f requires multiple analytical approaches:

Structural Characterization:

  • Spectroscopic Methods:

    • UV-Visible absorption spectroscopy to confirm heme coordination

    • Circular dichroism (CD) to assess secondary structure content

    • Nuclear magnetic resonance (NMR) for structural analysis of soluble domains

    • X-ray crystallography for high-resolution structure determination

  • Mass Spectrometry:

    • Intact protein mass analysis to confirm sequence and modifications

    • Peptide mapping to verify sequence and identify post-translational modifications

    • Hydrogen-deuterium exchange mass spectrometry to probe structural dynamics

Functional Characterization:

  • Electron Transfer Assays:

    • Redox potential determination using potentiometric titration

    • Electron transfer kinetics using flash photolysis and time-resolved spectroscopy

    • Reconstitution into liposomes for electron transport measurements

  • Binding Studies:

    • Surface plasmon resonance (SPR) to measure interactions with electron transfer partners

    • Isothermal titration calorimetry (ITC) to determine binding affinity and thermodynamics

    • Microscale thermophoresis for protein-protein interaction analysis

Integration with Photosynthetic Complexes:

  • Reconstitution Experiments:

    • Integration into nanodiscs or liposomes with other components of the electron transport chain

    • Measurement of proton pumping efficiency

    • Assessment of integration into thylakoid membranes in cyanobacterial systems

How should researchers address the unique genetic and transcriptomic features of Trichodesmium erythraeum when designing petA expression constructs?

The unusual genomic characteristics of T. erythraeum require careful construct design:

Construct Design Recommendations:

  • Promoter Selection Considerations:

    • Use the comprehensive TSS map of T. erythraeum to identify the exact start site for petA transcription

    • For heterologous expression, test both native promoters and host-specific strong promoters

    • Include 200-300 bp upstream of the TSS to capture potential regulatory elements

  • Codon Optimization Strategy:

    • Analyze the codon usage bias in T. erythraeum highly expressed genes

    • Optimize codons based on the host expression system while preserving critical regulatory sequences

    • Consider the impact of the unusual high non-coding genome content (40%) on expression efficiency

  • RNA Elements to Consider:

    • Check for potential regulatory ncRNAs that might interact with petA transcripts

    • Identify any antisense TSS (aTSS) that could produce asRNAs regulating petA expression

    • Screen for potential group II introns that might require processing

  • Expression Vector Features:

    • Include appropriate origin of replication for the host system

    • Select markers compatible with cyanobacterial hosts if expressing in related species

    • Consider including stabilizing elements to prevent recombination

    • Add affinity tags positioned to minimize interference with protein function

Construct Design Decision Matrix:

Design ElementOptionsRecommendation
PromoterNative vs. heterologousNative for studying regulation; strong heterologous for high yield
Coding sequenceGenomic vs. cDNAcDNA to avoid splicing requirements if introns present
Affinity tagN-terminal vs. C-terminalC-terminal tag to avoid interference with signal peptide/heme attachment
Codon optimizationFull vs. partialPartial optimization preserving key regulatory sequences
Vector backboneBroad-host vs. specializedBroad-host range if expression in multiple systems is planned

How can researchers overcome challenges in expressing functional cytochrome f with proper heme incorporation?

The production of properly folded cytochrome f with covalently attached heme presents significant challenges:

Common Issues and Solutions:

  • Poor Heme Incorporation:

    • Problem: Expression yields apocytochrome f without heme attachment

    • Solution: Co-express with cytochrome c maturation (CCM) proteins (CcmABCDEFGH) in E. coli

    • Alternative: Express in a cyanobacterial host with native heme attachment machinery

  • Protein Aggregation:

    • Problem: Formation of inclusion bodies during overexpression

    • Solution: Lower induction temperature (16-20°C), reduce expression rate with lower inducer concentration

    • Alternative: Express as a fusion with solubility-enhancing tags (MBP, SUMO)

  • Improper Folding:

    • Problem: Protein is soluble but non-functional

    • Solution: Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Alternative: Attempt in vitro refolding with gradual detergent dialysis

  • Low Yield in Cyanobacterial Hosts:

    • Problem: Expression levels insufficient for purification

    • Solution: Optimize light intensity and growth conditions specific to host

    • Alternative: Use stronger promoters or increase copy number of expression plasmid

Troubleshooting Decision Tree:

ObservationPossible CauseFirst InterventionSecondary Approach
No protein detectedToxicity to hostReduce expression levelUse tightly controlled inducible system
Protein present but no hemeMissing maturation factorsCo-express CCM systemSwitch to native host
Degraded proteinProteolytic instabilityAdd protease inhibitorsExpress in protease-deficient strains
Inactive proteinImproper foldingOptimize membrane extractionTry different detergents

What strategies can address the challenges of working with the unusual transcriptome of Trichodesmium erythraeum?

The complex transcriptional landscape of T. erythraeum requires specialized approaches:

Transcriptional Analysis Strategies:

  • Identifying True Transcription Start Sites:

    • Apply dRNA-seq methodology as described by Sharma et al.

    • Use TEX treatment to enrich for primary transcripts with 5'PPP (triphosphate) ends

    • Compare TEX-treated (+5'PPase) and untreated (-5'PPase) libraries to distinguish primary from processed transcripts

  • Detecting Regulatory ncRNAs:

    • Screen for antisense transcripts to petA using strand-specific RNA-seq

    • Identify potential regulatory elements using the classification system for TSS (gTSS, iTSS, aTSS, nTSS)

    • Verify functional importance through knockout or overexpression studies

  • Validating Transcript Processing:

    • Use northern blot analysis to confirm the presence of transcript intermediates

    • Apply split-read mapping to detect splicing events as shown in Fig. 5A

    • Perform RT-PCR with primers spanning potential processing sites

  • Addressing High Non-coding RNA Content:

    • Consider potential regulatory function of highly expressed ncRNAs

    • The most abundant RNAs in T. erythraeum originate from a >6,000 bp tandem repeat array

    • Test for interactions between these abundant ncRNAs and petA expression

Laboratory Protocol for Transcript Analysis:

StepMethodPurposeReference
RNA extractionPGTX buffer methodObtain high-quality total RNA
TEX treatmentTerminator-5′P-dependent-exonuclease digestionEnrich for primary transcripts
Library preparationdRNA-seq protocolDistinguish primary from processed transcripts
ValidationNorthern blotConfirm transcript size and processing
AnalysisSplit-read mappingDetect intron splicing

How might advances in understanding Trichodesmium erythraeum's unique genomic features impact future work with recombinant petA?

The continuing study of T. erythraeum's genome and transcriptome offers opportunities for advancing recombinant protein expression:

Emerging Research Directions:

  • Single-Cell Genomics Applications:

    • Investigation of natural population diversity in petA sequences

    • Estimation of diversification rates within wild populations

    • Identification of natural variants with potentially enhanced functional properties

    • As suggested in the literature, single-cell genomics could help understand diversification in wild Trichodesmium populations

  • Integration with Metagenomic Data:

    • Comparison of laboratory strains with natural populations

    • Analysis of metagenomic datasets from environments where T. erythraeum is prevalent

    • The search results indicate that metagenomic data from wild Trichodesmium colonies has already yielded insights about the DGR system

  • Application of New Transcriptomic Approaches:

    • Ribosome profiling to determine translation efficiency of petA

    • SHAPE-seq for RNA structure analysis of the petA transcript

    • Genome-wide protein-RNA interaction studies to identify regulatory factors

  • Systems Biology Integration:

    • Network analysis of photosynthetic gene expression patterns

    • Integration of transcriptomic, proteomic, and metabolomic data

    • Development of computational models of electron transport including cytochrome f function

Potential Impact on Recombinant Expression Strategies:

Genomic FeatureCurrent UnderstandingFuture Research PotentialImpact on Recombinant petA
Non-coding RNA content40% of genome is non-coding Identification of regulatory RNAs affecting petAImproved construct design incorporating regulatory elements
Group II intronsAt least 17 actively splicing introns Comprehensive mapping of all intronsEnhanced prediction of transcript processing requirements
DGR systemActive in wild populations, pseudogenized in lab Characterization of target specificityBetter assessment of sequence stability risks
TSS diversity6,080 identified promoters Complete promoter strength comparisonOptimal promoter selection for expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.