Recombinant Trichodesmium erythraeum ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase Subunit a (atpB)

ATP synthase subunit a (atpB) is a core component of the F₀ sector of ATP synthase, a membrane-embedded enzyme responsible for ATP synthesis in prokaryotes and eukaryotes. In Trichodesmium erythraeum, this subunit facilitates proton translocation, coupling proton motive force to ATP production . Recombinant versions of atpB enable biochemical and structural studies, offering insights into cyanobacterial bioenergetics and adaptation to marine environments.

Gene Information and Genomic Context

The atpB gene (locus tag: Tery_2204) is part of an operon encoding F₀F₁ ATP synthase subunits. Key genomic features include:

  • Synonyms: atpI .

  • Function: Proton channel formation and ATP synthesis .

  • Operon Structure: Co-transcribed with atpE (subunit C) and other ATP synthase genes .

Regulatory and Functional Insights

  • The atpB promoter shares regulatory motifs with ribosomal protein genes, suggesting coordinated expression under energy-demanding conditions .

  • Homologs in other cyanobacteria (e.g., Prochlorococcus) show conserved proton-channeling residues, highlighting evolutionary conservation .

Expression and Purification Protocol

  1. Expression: The atpB gene is cloned into E. coli vectors with a His tag for affinity chromatography .

  2. Purification: Nickel-column chromatography followed by buffer exchange into Tris/PBS with trehalose for stabilization .

  3. Reconstitution: Lyophilized protein is resuspended in sterile water (0.1–1.0 mg/mL) with glycerol (5–50%) for stability .

Quality Control

  • Purity: Validated via SDS-PAGE and mass spectrometry .

  • Activity: Functional assays confirm proton translocation capability in liposome models .

Functional and Research Applications

Recombinant atpB is utilized in:

  1. Mechanistic Studies: Elucidating proton transport mechanisms in ATP synthase .

  2. Structural Biology: Crystallization trials to resolve cyanobacterial ATP synthase architecture .

  3. Environmental Adaptation: Investigating T. erythraeum’s resilience to oceanic pH and salinity fluctuations .

Notable Findings

  • The protein’s two transmembrane helices are critical for proton channel stability .

  • Mutagenesis studies identify residues (e.g., Ile⁵⁰, Phe¹²⁰) essential for coupling efficiency .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
atpB; atpI; Tery_2204; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Trichodesmium erythraeum (strain IMS101)
Target Names
atpB
Target Protein Sequence
MLDVLNTINFLPLAELEVGQHFYWELGSFKIHGQILLTSWFVIALILLAAFISSLNVQRI PSGMQNFMESVLEFIRSLTKDQIGEKDYRPWVPFIGTLFLFIFVSNWSGALVPWKVIELP SGELAAPTSDINTTVALALLTSIAYFYAGISKKGLGYFAGYAEPVPFMVPFKIIEDFTKP LSLSFRLFGNILADELVVGVLVLLVPLFIPLPLMVLGLFLSAIQALIFATLAANYIGEAL EEHGAEDHD
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel. It plays a crucial role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of ATP synthase in Trichodesmium erythraeum?

ATP synthase in cyanobacteria like Trichodesmium erythraeum functions similarly to mitochondrial ATP synthase, consisting of two main domains: F₁ and F₀. The F₁ domain contains three α, three β, and other subunits responsible for ATP synthesis, while the F₀ domain forms the proton channel embedded in the membrane . In Trichodesmium erythraeum, ATP synthase plays a crucial role in energy production that supports nitrogen fixation, a metabolically expensive process requiring significant ATP input.

The enzyme utilizes the proton gradient established across the thylakoid membrane during photosynthesis to generate ATP. This proton-motive force has two components: a pH differential and an electrical membrane potential (Δψm) . The energy released from proton movement drives the rotation of the c-ring in F₀ and the γ, δ, and ε subunits in F₁, facilitating ATP synthesis through conformational changes in the catalytic sites.

How does ATP synthase function relate to nitrogen fixation capacity in Trichodesmium erythraeum?

ATP synthase activity is integrally linked to nitrogen fixation in Trichodesmium erythraeum through energy provision. Nitrogen fixation requires substantial ATP to break the triple bond in N₂ molecules. Research has shown that under iron and phosphorus co-limited conditions, Trichodesmium exhibits enhanced N₂ fixation capacity that coincides with the expression of alternative ATP generation pathways .

These alternative pathways appear to be both iron-efficient and produce minimal net oxygen, which is beneficial since nitrogenase is oxygen-sensitive. Transcriptomic data indicates that Trichodesmium employs unique molecular and physiological responses as adaptations to exploit the Fe and P co-limited niche they construct . The ATP synthase complex must therefore maintain functionality even under nutrient stress conditions to support nitrogen fixation.

How does nutrient availability affect ATP synthase expression and activity in Trichodesmium erythraeum?

Transcriptomic analyses have revealed that Trichodesmium erythraeum modulates gene expression in response to nutrient availability, which indirectly affects ATP synthase activity:

  • Under iron limitation: Progressive upregulation of known iron-stress biomarker genes occurs, potentially affecting electron transport components including those associated with ATP synthase .

  • Under phosphorus limitation: Genes involved in acquisition of diverse P sources are upregulated, including high-affinity inorganic P transporters (pstS, sphX), alkaline phosphatases (phoA, phoX), and phosphonate-related genes (phnCDEEGHIJKLM) .

  • Under moderate Fe and P availability: Genes involved in N₂ fixation are upregulated, suggesting optimal conditions for ATP production and nitrogen fixation .

The interplay between nutrient availability and ATP synthase function is critical, as Trichodesmium must balance energy production with nutrient constraints to maintain cellular functions, particularly nitrogen fixation.

What expression systems are most effective for producing recombinant Trichodesmium erythraeum ATP synthase subunit a?

Based on successful expression of other Trichodesmium erythraeum proteins, E. coli represents a viable heterologous expression system for ATP synthase subunit a. Drawing from the methodologies used for ATP synthase subunit c (atpE), expression in E. coli with an N-terminal His-tag facilitates purification and characterization .

The expression protocol should include:

  • Gene synthesis optimized for E. coli codon usage

  • Cloning into an expression vector with an inducible promoter (e.g., pET system)

  • Transformation into an E. coli strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Induction with IPTG at reduced temperatures (16-20°C) to minimize inclusion body formation

  • Gentle cell lysis and membrane fraction isolation

This approach has proven successful for other membrane proteins from cyanobacteria and could be adapted for atpB expression.

What purification strategies yield highest purity and activity for recombinant Trichodesmium erythraeum ATP synthase components?

For purification of recombinant Trichodesmium erythraeum ATP synthase subunit a, a multi-step approach is recommended:

  • Membrane solubilization: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin that preserve protein structure and activity.

  • Immobilized metal affinity chromatography (IMAC): For His-tagged constructs, use Ni-NTA or Co-NTA resins with optimized imidazole gradients to minimize non-specific binding .

  • Size-exclusion chromatography: To separate different oligomeric states and remove aggregates.

  • Ion exchange chromatography: As a polishing step to achieve highest purity.

Throughout purification, maintain buffer conditions that mimic the physiological environment, including:

  • pH 7.5-8.0 (similar to cyanobacterial cytoplasm)

  • 100-150 mM NaCl

  • 10% glycerol as stabilizer

  • 0.02-0.05% detergent (below critical micelle concentration)

  • Protease inhibitors

For storage, lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been successful for other Trichodesmium proteins .

How can researchers assess the functional integrity of recombinant ATP synthase components?

Functional integrity assessment requires multiple complementary approaches:

Structural integrity assays:

  • Circular dichroism spectroscopy to verify secondary structure

  • Limited proteolysis to assess proper folding

  • Thermal shift assays to determine stability

Functional assays:

  • ATP hydrolysis activity using colorimetric phosphate release assays

  • Proton pumping assays using pH-sensitive fluorescent dyes

  • Reconstitution into liposomes to measure ATP synthesis driven by artificial proton gradients

Binding assays:

  • Interaction studies with other ATP synthase subunits using pull-down assays

  • Native PAGE to assess complex formation

  • Cross-linking studies to capture transient interactions

When comparing recombinant protein to native ATP synthase, researchers should consider that the activity of the isolated subunit may differ from its behavior in the complete ATP synthase complex.

How can researchers investigate the relationship between ATP synthase activity and nitrogen fixation in Trichodesmium erythraeum?

To investigate this relationship, researchers can employ several approaches:

Transcriptomic and proteomic correlation analysis:

  • Conduct RNA-seq and proteomics under varying nutrient conditions

  • Correlate expression patterns of ATP synthase genes with nitrogenase genes

  • Analyze post-translational modifications that might regulate ATP synthase activity

Metabolic flux analysis:

  • Use isotope labeling (e.g., ¹³C-glucose, ¹⁵N-nitrogen gas) to trace energy flow

  • Quantify ATP/ADP ratios under different nitrogen fixation conditions

  • Measure oxygen consumption and hydrogen production simultaneously with ATP synthesis rates

Inhibitor studies:

  • Apply specific inhibitors of ATP synthase (oligomycin) or nitrogenase (acetylene)

  • Observe effects on both ATP production and nitrogen fixation rates

  • Analyze the H₂:N₂ production ratio, which has been shown to reflect energy allocation in Trichodesmium

The light intensity and spectral composition significantly affect the H₂:N₂ ratio, indicating a direct link between photosynthetic electron transport, ATP production, and nitrogen fixation efficiency . Experiments should consider these variables when designing experiments to investigate ATP synthase-nitrogenase relationships.

What approaches can be used to study ATP synthase assembly in Trichodesmium erythraeum?

Studying ATP synthase assembly in Trichodesmium erythraeum can draw from established methods in other organisms while accounting for cyanobacterial-specific aspects:

Assembly tracking approaches:

  • Pulse-chase experiments with radioactive labeling of newly synthesized proteins

  • Temporal analysis of complex formation using blue native PAGE

  • Identification of assembly intermediates through immunoprecipitation with subunit-specific antibodies

Genetic manipulation strategies:

  • CRISPR-Cas9 gene editing to introduce tagged versions of ATP synthase subunits

  • Creation of conditional mutants to identify assembly factors

  • Heterologous expression of fluorescently tagged subunits to visualize assembly in vivo

Computational modeling:

  • Apply frameworks like MiMoSA to model ATP synthase assembly within the context of cellular metabolism

  • Predict assembly pathways based on protein-protein interaction networks

Based on studies in other organisms, ATP synthase assembly likely involves the formation of distinct modules (similar to the c-ring, F₁, and subunit a/A6L modules in yeast) that converge at later stages . The order of assembly may be particularly important in cyanobacteria given the dual location of ATP synthase in both thylakoid and cytoplasmic membranes.

How do environmental factors affect ATP synthase function in Trichodesmium erythraeum?

Environmental factors significantly impact ATP synthase function in Trichodesmium erythraeum, with important implications for cellular energetics:

Iron availability effects:

  • Iron limitation affects electron transport components upstream of ATP synthase

  • Transcriptomic studies show upregulation of iron-stress biomarker genes with decreasing Fe availability

  • Reduced iron may lead to alternative electron transport pathways to maintain ATP production

Phosphorus availability effects:

  • Phosphorus is essential for ATP synthesis

  • Under P limitation, Trichodesmium upregulates genes for alternative P acquisition

  • P stress may alter the ATP:ADP ratio and affect ATP synthase regulation

Light effects:

  • Light intensity and spectral composition directly impact the proton gradient driving ATP synthesis

  • Studies show the H₂:N₂ production ratio is controlled by light intensity and spectral composition

  • Trichodesmium grown at different light intensities (e.g., 50 μmol photons·m⁻²·s⁻¹) shows different saturation points for nitrogenase activity

These environmental responses represent adaptations that allow Trichodesmium to maintain energy production under varying conditions in oligotrophic oceans.

What are common challenges in expressing and purifying recombinant Trichodesmium erythraeum ATP synthase components?

Researchers commonly encounter several challenges when working with recombinant ATP synthase components:

Expression challenges:

  • Membrane protein toxicity to host cells

  • Inclusion body formation

  • Improper membrane insertion

  • Codon usage bias

Purification challenges:

  • Detergent selection affecting stability and activity

  • Co-purification of unwanted host proteins

  • Loss of essential lipids during purification

  • Aggregation during concentration

Recommended solutions:

  • Use low-temperature induction (16-20°C) to reduce inclusion body formation

  • Test multiple detergents for optimal solubilization

  • Add stabilizers like glycerol (10-50%) and trehalose (6%) to purification buffers

  • Consider adding specific lipids during purification to maintain native-like environment

  • Optimize buffer composition based on the isoelectric point of the target protein

  • Store as lyophilized powder or aliquot with glycerol and store at -20°C/-80°C to prevent freeze-thaw damage

For recombinant proteins showing low expression, codon optimization for E. coli and fusion with solubility-enhancing tags (MBP, SUMO) may improve yields.

How can researchers validate the structure-function relationship of recombinant ATP synthase subunits?

Validating structure-function relationships requires multiple complementary approaches:

Structural analysis methods:

  • X-ray crystallography or cryo-EM for high-resolution structures

  • Hydrogen-deuterium exchange mass spectrometry to map flexible regions

  • FTIR spectroscopy to analyze secondary structure in membrane environments

Functional correlation:

  • Site-directed mutagenesis of conserved residues

  • Activity assays following each mutation to correlate structure with function

  • Cross-linking studies to identify interaction interfaces between subunits

Computational approaches:

  • Molecular dynamics simulations to study conformational changes

  • Homology modeling based on related ATP synthases with known structures

  • Docking studies to predict subunit interactions

These approaches can be combined to develop a comprehensive understanding of how structural elements contribute to the protein's function in ATP synthesis and its integration into the complete ATP synthase complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.