Recombinant Trichodesmium erythraeum Cytochrome b6-f complex iron-sulfur subunit (petC)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC; Tery_1799; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Trichodesmium erythraeum (strain IMS101)
Target Names
petC
Target Protein Sequence
MAQAEGTPDVPSMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPSSGGSGGGVTAKDAL
GNDIIVSEFLANHNSGERTLAQGLKGDPTYVVIEGEQTLAEYGLNAVCTHLGCVVPWNGS
ENKFICPCHGSQYDNTGKVVRGPAPLSLALVHANVSDDKLVFTQWEETDFRTGEKPWWV
Uniprot No.
Target Background
Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
KEGG: ter:Tery_1799
STRING: 203124.Tery_1799
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
