Recombinant Trichodesmium erythraeum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Trichodesmium erythraeum Cytochrome b6-f complex subunit 4 (petD) refers to a specific protein expressed using recombinant DNA technology. It is a subunit of the cytochrome b6-f complex found in the cyanobacterium Trichodesmium erythraeum . The cytochrome b6-f complex is an enzyme that functions in the electron transport chain during photosynthesis .

Cytochrome b6-f Complex

The cytochrome b6-f complex (plastoquinol/plastocyanin reductase) is present in the thylakoid membranes of chloroplasts in plants, green algae, and cyanobacteria . It mediates the transfer of electrons from Photosystem II to Photosystem I, which is a crucial step in photosynthesis . Concurrently, it pumps protons into the thylakoid space, creating an electrochemical gradient that drives ATP synthesis .

The general reaction that the cytochrome $$b_6f$$ complex catalyzes is:

$$ \text{plastoquinol} + \text{2 oxidized plastocyanin} + \text{2 }H^+{\text{side 1}} \rightarrow \text{plastoquinone} + \text{2 reduced plastocyanin} + \text{4 }H^+{\text{side 2}} $$

Subunit Composition and Structure

The cytochrome b6-f complex is a dimer, with each monomer consisting of eight subunits . These subunits include:

  • Cytochrome f (32 kDa)

  • Cytochrome b6 (25 kDa)

  • Rieske iron-sulfur protein (19 kDa)

  • Subunit IV (17 kDa)

  • Four small subunits: PetG, PetL, PetM, and PetN (3-4 kDa)

The petD gene encodes subunit 4 of this complex .

PetD (Cytochrome b6-f complex subunit 4)

PetD is a subunit of the cytochrome b6-f complex . Creative Biomart produces a recombinant full-length Trichodesmium erythraeum Cytochrome b6-f complex subunit 4(petD) protein, His-tagged, which is expressed in E. coli .

Table 1: Recombinant Trichodesmium erythraeum Cytochrome b6-f complex subunit 4 (petD) Protein Information

FeatureDescription
Product OverviewRecombinant Full Length Trichodesmium erythraeum Cytochrome b6-f complex subunit 4(petD) Protein (Q116S6) (1-160aa), fused to N-terminal His tag, was expressed in E. coli.
Cat. No.RFL7286TF
Protein Accession NoQ116S6

Function of Cytochrome b6-f Complex in Photosynthesis

The cytochrome b6-f complex is essential for both non-cyclic and cyclic electron transfer in photosynthesis :

  1. Non-cyclic electron transfer: Transfers electrons between Photosystem II and Photosystem I .

    $$H_2O \rightarrow \text{Photosystem II} \rightarrow QH_2 \rightarrow \text{Cyt }b_6f \rightarrow Pc \rightarrow \text{Photosystem I} \rightarrow NADPH$$

  2. Cyclic electron transfer: When $$NADP^+$$ is unavailable, cytochrome b6-f contributes to creating a proton gradient for ATP synthesis .

    $$QH_2 \rightarrow \text{Cyt }b_6f \rightarrow Pc \rightarrow \text{Photosystem I} \rightarrow Q$$

Role of PetM

Research indicates that PetM, another subunit of the cytochrome b6f complex, is essential for the stabilization and function of the complex in Arabidopsis . A study showed that an Arabidopsis thaliana PetM mutant displayed a bleached phenotype, disrupted photosynthetic electron transport, and loss of photo-autotrophy, similar to the Arabidopsis PetC mutant . This suggests that PetM is needed to maintain the function of the cytochrome b6f complex, possibly by forming a tight structure that stabilizes the core of the complex .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag type, please specify this in your order; we will prioritize its implementation.
Synonyms
petD; Tery_1136; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Trichodesmium erythraeum (strain IMS101)
Target Names
petD
Target Protein Sequence
MSTLKKPDLSDPQLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIVGTIALCVGLAVLDPA MIGEPADPFATPLEILPEWYFWPVFQILRVVPNKLLGIVAMASIPLGLMLVPFIESVNKF QNPFRRPVATAVFLFGTAVTLWLGIGATLPIDKSLTFGLF
Uniprot No.

Target Background

Function

Function: Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the relationship between petD expression and iron availability in Trichodesmium erythraeum?

Iron availability significantly impacts petD expression in Trichodesmium erythraeum. Under iron-depleted conditions (5 nmol/L Fe), Trichodesmium exhibits altered photosynthetic gene expression compared to iron-replete conditions (250 nmol/L Fe). Metatranscriptome sequencing reveals that genes related to photosynthesis and respiration, including those involved in the cytochrome b6-f complex function, are downregulated in iron-limited conditions . For researchers studying petD specifically, it is recommended to monitor both gene expression and protein levels using qRT-PCR and Western blotting, respectively, across varying iron concentrations (5-250 nmol/L) to establish a clear expression profile.

How does petD function differ in nitrogen-fixing versus photosynthetic cells within Trichodesmium filaments?

Trichodesmium filaments exhibit functional differentiation between cells specialized for nitrogen fixation (diazocytes) and those dedicated to photosynthesis. In spatial segregation models, approximately 15% of cells within a filament function as diazocytes, while the remaining cells focus on photosynthesis . The petD gene, being involved in the cytochrome b6-f complex, plays different roles in these cell types. In photosynthetic cells, petD participates in linear photosynthetic electron transport (LPET) and alternative electron transport (AET) pathways. To study these differences, researchers should employ single-cell transcriptomics or immunolabeling techniques to distinguish petD expression and localization between the cell types within a single filament.

What structural features distinguish Trichodesmium erythraeum petD from other cyanobacterial homologs?

Trichodesmium erythraeum petD contains conserved domains typical of cytochrome b6-f complex subunit 4, but exhibits unique adaptations reflecting its marine, nitrogen-fixing lifestyle. To characterize these differences, researchers should perform comparative sequence analysis across multiple cyanobacterial species using tools such as MUSCLE or Clustal Omega for multiple sequence alignment. Hydrophobicity analysis using Kyte-Doolittle plots can identify transmembrane regions, while 3D protein modeling using I-TASSER or AlphaFold can predict structural differences that may relate to function under iron-limited conditions common in Trichodesmium's natural habitat.

What expression systems are most effective for producing recombinant Trichodesmium erythraeum petD protein?

Table 1. Comparison of Expression Systems for Recombinant petD Production

Expression SystemAdvantagesDisadvantagesYield (mg/L)Functional Activity
E. coli BL21(DE3)Rapid growth, high yieldInclusion body formation, lack of PTMs15-20Moderate
E. coli ArcticExpressBetter folding at lower temperatureSlower growth8-12Good
Synechocystis PCC 6803Native-like processing, PTMsLower yield, slower growth3-5Excellent
Cell-free systemAvoids toxicity issuesExpensive, limited scale1-3Variable

For recombinant petD expression, E. coli BL21(DE3) provides high yield but often produces inclusion bodies requiring refolding. When designing expression constructs, include a His6-tag for purification, optimize codon usage for the host system, and consider fusion partners like SUMO or MBP to enhance solubility. Expression at lower temperatures (16-18°C) after induction with 0.1-0.5 mM IPTG often improves folding. For membrane protein expression, specialized strains like C41(DE3) or C43(DE3) may provide better results. Verify expression using Western blotting with antibodies against the tag or petD itself.

What purification protocol yields functionally active recombinant petD protein?

Purification of recombinant petD requires specialized approaches due to its membrane-associated nature. The optimal protocol involves:

  • Cell lysis using a combination of enzymatic (lysozyme, 1 mg/ml, 30 min) and mechanical (sonication, 10 cycles of 15s on/45s off) methods in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and 1% mild detergent (DDM or LDAO).

  • Solubilization of membrane fraction (if using membrane-targeted expression) with 1% DDM for 1 hour at 4°C with gentle rotation.

  • Affinity chromatography using Ni-NTA resin with stepwise imidazole elution (20, 50, 250 mM).

  • Size exclusion chromatography using Superdex 200 in buffer containing 0.05% DDM to maintain protein solubility.

  • Assessment of purity by SDS-PAGE and functional activity through electron transport assays using artificial electron donors and acceptors.

Researchers should monitor protein oxidation during purification by including reducing agents like 1-5 mM DTT or 2-10 mM β-mercaptoethanol in buffers, as the cytochrome b6-f complex contains redox-sensitive components.

How can researchers assess the functional integrity of recombinant petD in vitro?

Functional assessment of recombinant petD involves multiple complementary approaches:

  • Spectroscopic analysis: Measure absorbance spectra between 400-700 nm to detect characteristic peaks of properly folded cytochrome components. The presence of expected peaks at specific wavelengths (typically around 550-560 nm for b-type cytochromes) indicates correct heme incorporation.

  • Electron transport assays: Use artificial electron donors (e.g., reduced decylplastoquinone) and acceptors (e.g., oxidized plastocyanin or cytochrome c) to measure electron transfer rates spectrophotometrically.

  • Reconstitution experiments: Incorporate purified petD into liposomes with other cytochrome b6-f complex components to assess if electron transport functionality can be restored.

  • Thermal stability assays: Techniques such as differential scanning fluorimetry can assess protein stability and proper folding.

  • Binding assays: Isothermal titration calorimetry or surface plasmon resonance to measure interaction with known binding partners.

How does petD expression correlate with nitrogen fixation capacity in Trichodesmium under fluctuating environmental conditions?

The relationship between petD expression and nitrogen fixation involves complex regulatory networks. Under iron limitation, Trichodesmium shows decreased expression of genes related to photosynthesis, respiration, and nitrogen fixation . To investigate this correlation:

  • Design experiments comparing wild-type Trichodesmium with petD mutants (using gene editing techniques) under varying environmental conditions.

  • Monitor nitrogen fixation using acetylene reduction assays or 15N2 incorporation methods alongside petD expression levels (qRT-PCR) and protein abundance (immunoblotting).

  • Employ metabolic flux analysis to track carbon and nitrogen flow through central metabolism.

  • Use transcriptomics to identify co-regulated genes under iron limitation that may form part of the regulatory network connecting photosynthesis and nitrogen fixation.

Research has shown that photosynthesis and nitrogen fixation are temporally regulated in Trichodesmium, though spatial segregation between diazocytes and photosynthetic cells is not mandatory for effective nitrogen fixation . The petD gene likely plays a role in this temporal regulation by influencing electron flow during different metabolic states.

What role does petD play in the formation of IsiA-photosystem supercomplexes under iron-limited conditions?

Under iron-depleted conditions, Trichodesmium exhibits increased expression of IsiA (Iron stress-induced protein A), which is homologous to the CP43 of photosystem II . The formation of IsiA-photosystem supercomplexes represents an adaptation to iron limitation. To investigate petD's role in this process:

  • Conduct blue-native PAGE analysis of thylakoid membranes from iron-replete versus iron-depleted cultures to visualize supercomplex formation.

  • Perform co-immunoprecipitation experiments using anti-petD antibodies to identify interaction partners under different iron conditions.

  • Use FRET or BRET assays to measure proximity between petD and IsiA proteins in vivo.

  • Employ cryo-electron microscopy to determine structural organization of these supercomplexes and petD's position within them.

The 77K fluorescence emission spectroscopy shows characteristic peaks at 685 nm (indicating IsiA production) and 715 nm (photosystem I), with increased relative intensity at 685 nm under iron-depleted conditions . This suggests reorganization of the photosynthetic apparatus, likely involving altered cytochrome b6-f complex function and petD arrangement.

How can site-directed mutagenesis of petD elucidate electron transport mechanisms in Trichodesmium?

Site-directed mutagenesis provides powerful insights into structure-function relationships of petD. When designing mutagenesis experiments:

  • Target conserved residues identified through multiple sequence alignment of petD across cyanobacterial species.

  • Focus on residues predicted to interact with quinones, heme groups, or other electron transport components.

  • Create a library of point mutations using overlap extension PCR or commercial site-directed mutagenesis kits.

  • Express and purify mutant proteins using the protocols described in section 2.2.

  • Analyze electron transport kinetics of each mutant compared to wild-type protein.

Table 2. Potential petD Mutation Targets and Expected Effects

Target RegionResidue(s)Predicted FunctionExpected Effect of Mutation
Q-cycle siteHis/Lys in quinone binding pocketProton transferAltered electron transport rate
Transmembrane domainsConserved aromatic residuesStructural integrityDestabilization of complex
Stromal loopCharged residuesInteraction with ferredoxinAltered electron donor specificity
Lumenal regionAsp/Glu residuespH sensingChanged response to lumen acidification

Why might recombinant petD show reduced activity compared to native protein, and how can this be addressed?

Several factors can contribute to reduced activity of recombinant petD:

  • Improper folding: Native membrane proteins often require specific lipid environments and chaperones for correct folding. Address by using mild detergents (DDM, LDAO) during purification and consider co-expression with cyanobacterial chaperones.

  • Missing cofactors: The cytochrome b6-f complex contains heme groups and iron-sulfur clusters. Supplement expression media with iron sources (50-100 μM ferric citrate) and ensure purification buffers maintain reducing conditions to preserve Fe-S clusters.

  • Lack of post-translational modifications: If specific modifications are required, consider expression in cyanobacterial hosts like Synechocystis rather than E. coli.

  • Detergent effects: Test multiple detergents (DDM, LDAO, OG) at various concentrations (0.02-1%) to identify optimal conditions that maintain protein structure without inhibiting activity.

  • Oxidative damage: Include antioxidants (5 mM ascorbate, 1 mM DTT) in all buffers and handle samples under nitrogen atmosphere when possible.

To verify activity recovery, compare electron transport rates using standard assays with artificial donors and acceptors across different preparation methods.

How can researchers distinguish between direct and indirect effects when studying petD gene knockdown or mutation?

Distinguishing direct from indirect effects in petD studies requires multiple complementary approaches:

  • Employ quantitative research methods combining both targeted and global analyses:

    • Targeted assays: Measure specific electron transport rates, redox states of electron carriers, and proton translocation directly affected by petD function.

    • Global analyses: Use transcriptomics, proteomics, and metabolomics to identify broader cellular responses.

  • Conduct time-course experiments to separate immediate (likely direct) from delayed (likely indirect) effects following petD disruption.

  • Use genetic complementation with wild-type petD to verify phenotypes are specifically due to petD disruption.

  • Create a series of petD variants with increasing severity of defects to establish dose-response relationships.

  • Employ specific inhibitors of cytochrome b6-f function (e.g., DBMIB) as controls to distinguish petD-specific effects from general disruption of electron transport.

Remember that in complex systems like Trichodesmium, which balances photosynthesis and nitrogen fixation, network effects can propagate rapidly, making strict direct/indirect distinctions challenging .

What are the critical considerations when interpreting petD expression data from mixed microbial communities containing Trichodesmium?

Interpreting petD expression in mixed communities requires specialized approaches:

  • Design highly specific primers for Trichodesmium erythraeum petD that don't amplify homologs from other cyanobacteria or photosynthetic organisms.

  • Employ quantitative techniques that can distinguish between species:

    • Metagenomic sequencing with taxonomic binning

    • Species-specific qPCR with standard curves

    • Targeted proteomics using unique peptides from Trichodesmium petD

  • Consider interactions between species that may influence expression:

    • Siderophore-producing organisms can alter iron availability

    • Symbiotic relationships may influence gene regulation

    • Competition for resources may alter expression patterns

  • Use appropriate statistical methods for mixed community data:

    • Account for compositional effects using techniques like centered log-ratio transformation

    • Consider using mixed effect models to separate species-specific from community-level effects

Research shows that interactions between Trichodesmium and other microorganisms like Synechococcus can significantly impact gene expression patterns, including photosynthesis-related genes like petD .

How are systems biology approaches being applied to understand petD's role in Trichodesmium's metabolic network?

Systems biology offers powerful tools for understanding petD within Trichodesmium's complex metabolic network:

  • Genome-scale metabolic models (GEMs): Researchers are developing constraint-based metabolic models that incorporate petD-dependent electron transport to simulate energy flow through Trichodesmium metabolism under different environmental conditions.

  • Multi-omics integration: Advanced studies combine transcriptomics, proteomics, and metabolomics data to create comprehensive models of how petD expression correlates with broader metabolic shifts, particularly during diurnal cycles when nitrogen fixation and photosynthesis are temporally separated.

  • Flux balance analysis: This computational approach helps predict how alterations in petD function might redirect electron flow through alternative pathways.

  • Protein-protein interaction networks: Techniques like crosslinking mass spectrometry are being used to map the interaction landscape of petD within the thylakoid membrane.

  • Agent-based modeling: Simulating individual cells within Trichodesmium filaments to understand how cell-to-cell communication and metabolite exchange influence photosynthetic electron transport and nitrogen fixation at the community level.

These approaches help researchers understand how photosynthesis and nitrogen fixation are balanced in Trichodesmium, which doesn't necessarily require spatial segregation of these processes .

What are the implications of climate change factors on petD function and expression in Trichodesmium?

Climate change presents multiple stressors that may impact petD function in Trichodesmium:

  • Ocean acidification: Lower pH may affect the proton gradient necessary for cytochrome b6-f complex function. Research should examine petD expression and protein activity across pH ranges (7.6-8.2) simulating current and projected ocean conditions.

  • Rising temperatures: Higher temperatures may alter protein folding and stability of the cytochrome b6-f complex. Thermal stability assays of recombinant petD at temperature ranges from 25-35°C can assess potential impacts.

  • Changing iron availability: Climate-induced changes in dust deposition and ocean circulation may alter iron availability. Compare petD expression patterns under various iron concentrations (1-250 nmol/L) relevant to current and projected conditions.

  • Increased stratification: Stronger water column stratification may alter light regimes and nutrient availability. Investigate petD expression under simulated stratification conditions with varying light intensities and nutrient profiles.

Experimental designs should employ both laboratory studies with controlled parameters and mesocosm approaches that better simulate complex environmental changes. Mixed-method research combining quantitative measurements of electron transport rates with qualitative assessment of adaptive responses will provide the most comprehensive understanding .

How can genetic engineering of petD advance bioenergy applications utilizing Trichodesmium's photosynthetic machinery?

Genetic engineering of petD offers several promising avenues for bioenergy applications:

To pursue these directions, researchers should:

  • Establish reliable transformation protocols for Trichodesmium or consider using more genetically tractable cyanobacterial models for initial proof-of-concept.

  • Develop high-throughput screening methods to evaluate electron transport efficiency and bioenergy outputs.

  • Apply directed evolution approaches to generate and select beneficial petD variants.

  • Consider the ethical implications and ecological risks of releasing engineered strains, particularly given Trichodesmium's important ecological role in marine nitrogen fixation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.