Recombinant Trichodesmium erythraeum Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Overview

Recombinant Trichodesmium erythraeum Glycerol-3-phosphate acyltransferase (PlsY) is a bacterial enzyme engineered for laboratory studies to investigate lipid biosynthesis pathways. This enzyme catalyzes the initial step of phospholipid formation by transferring an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA) . It is encoded by the plsY gene (UniProt ID: Q10ZX6; locus tag: Tery_3050) in T. erythraeum strain IMS101, a marine diazotrophic cyanobacterium critical for oceanic nitrogen fixation .

Key Molecular Attributes:

PropertyDetail
Gene NameplsY (Tery_3050)
Protein Length228 amino acids (full-length recombinant protein)
Expression SystemEscherichia coli
TagN-terminal His-tag (variable based on production process)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions–20°C (short-term); –80°C (long-term)

Amino Acid Sequence

The recombinant PlsY protein includes residues 1–228 of the native enzyme. Its sequence begins with MINWLVLNAVILIVAYLLGATPSGYWIGSWFYGVDIREQ... and contains conserved motifs for acyltransferase activity, including regions critical for substrate binding (e.g., G3P and acyl-phosphate) .

Enzymatic Mechanism

PlsY operates via a two-step catalytic process:

  1. Acyl-phosphate binding: Utilizes acyl-phosphate as a donor.

  2. G3P acylation: Transfers the acyl group to G3P, forming LPA .

This reaction is critical for synthesizing membrane lipids, particularly under phosphorus (P)-limited conditions. Trichodesmium substitutes phospholipids with sulfur-containing lipids (e.g., sulfolipids) to reduce cellular P demand, a process facilitated by enzymes like PlsY .

Lipid Remodeling Under P Limitation

Trichodesmium thrives in oligotrophic oceans by remodeling its lipid membrane composition. Key findings include:

  • Phospholipid substitution: PlsY activity supports lipid turnover, enabling replacement of phosphatidylglycerol (PG) with sulfolipids like sulfoquinovosyldiacylglycerol (SQDG) .

  • Coordination with other enzymes:

    • SqdB: Upregulated during P stress to synthesize SQDG .

    • GDPD (Tery_2777): Hydrolyzes phospholipids, releasing phosphate for reuse .

Biochemical Studies

  • Enzyme kinetics: Recombinant PlsY is used to study substrate specificity and catalytic efficiency. Competitive inhibition models (Michaelis-Menten) are applied to analyze interactions with acyl-phosphate analogs .

  • Structural biology: Crystallization efforts aim to resolve active-site architecture for inhibitor design .

Ecological Relevance

  • Nutrient cycling: PlsY-mediated lipid remodeling allows Trichodesmium to dominate low-P marine ecosystems, contributing ~50% of oceanic nitrogen fixation .

  • Climate interactions: Lipid substitutions reduce cellular P quotas, influencing carbon export efficiency in marine biogeochemical cycles .

Research Challenges and Future Directions

  • Heterologous expression limitations: Trichodesmium’s complex regulatory networks hinder functional studies in non-native hosts like E. coli .

  • Metabolic modeling: Integrate PlsY kinetics into genome-scale models (e.g., MiMoSA) to predict lipid dynamics under environmental stressors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Tery_3050; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Trichodesmium erythraeum (strain IMS101)
Target Names
plsY
Target Protein Sequence
MINWLVLNAVILIVAYLLGATPSGYWIGSWFYGVDIREQGSGSTGATNVLRTLGNVPALV VLVIDIFKGALAIALVRYIYSLVFAQNLTIIAGVTDIDTAKEWMVIIAGLIAIVGHTKSI WIGFKGGKSVASSLGILLAISWVVGLGTLSVFIVVLTISRIVSLSSIIAAISVSGLMFFT GQPLPYQIFAITGGIYVIWRHISNIERLLACKEPRIGQKLSTEQKMNK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Why is recombinant expression of Trichodesmium erythraeum plsY scientifically significant?

Recombinant expression of Trichodesmium erythraeum plsY provides insights into membrane lipid biosynthesis in marine cyanobacteria, which are major contributors to oceanic nitrogen fixation. Studying this enzyme helps understand how Trichodesmium adapts its membrane composition to environmental changes, which is crucial considering its ecological importance. Trichodesmium spp. contribute approximately 27% of new production in subtropical North Pacific Ocean ecosystems . The ability to produce and study recombinant plsY allows researchers to investigate how this key metabolic enzyme contributes to Trichodesmium's survival in varying oceanic conditions and its subsequent impact on global nitrogen cycling.

What are the basic biochemical properties of Trichodesmium erythraeum plsY?

Trichodesmium erythraeum plsY is a membrane-associated enzyme with an approximate molecular weight of 25-30 kDa. The enzyme requires divalent metal ions (typically Mg²⁺) for activity and demonstrates optimal activity at pH ranges consistent with marine conditions (pH 7.5-8.5). The enzyme typically shows temperature-dependent activity patterns that align with Trichodesmium's growth temperature range, with optimal activity around 25-30°C, which corresponds to the temperature ranges where Trichodesmium shows optimal growth rates in natural environments . The substrate specificity generally favors medium to long-chain fatty acids, reflecting the membrane composition required for survival in marine environments.

What are the optimal expression systems for recombinant Trichodesmium erythraeum plsY?

Based on experience with similar membrane-associated proteins, E. coli BL21(DE3) strains are generally the preferred expression system for Trichodesmium erythraeum plsY. This strain accounts for 65% of recombinant enzyme expression cases in industrial biotechnology applications . For plsY specifically, consider these methodological approaches:

  • Expression vector selection: pET series vectors with T7 promoter systems offer controlled induction and high expression levels.

  • Strain considerations: BL21(DE3) derivatives optimized for membrane proteins, such as C41(DE3) or C43(DE3), may improve yields of functional plsY.

  • Codon optimization: Trichodesmium's codon usage differs from E. coli, so codon optimization or use of Rosetta strains that supply rare tRNAs can enhance expression.

  • Temperature modulation: Lower expression temperatures (16-20°C) often improve folding of membrane-associated proteins like plsY.

For researchers encountering persistent solubility issues, specialty strains like ArcticExpress(DE3) that promote folding at lower temperatures may be beneficial .

What strategies can improve solubility of recombinant Trichodesmium erythraeum plsY?

Membrane-associated proteins like plsY frequently form inclusion bodies when overexpressed. To improve solubility:

Solubility StrategyMethodologySuccess RateConsiderations
Fusion tagsN-terminal MBP, SUMO, or Trx fusionHighMay affect enzyme activity; cleavage required
Expression temperatureGrowth at 15-20°C after inductionModerate-HighExtends expression time significantly
Inducer concentrationReduce IPTG to 0.1-0.2 mMModerateBalances expression level and folding time
Media supplementationAddition of glycerol (3-5%) and mild detergentsModerateHelps stabilize membrane proteins
Co-expressionChaperones (GroEL/GroES, DnaK)VariableStrain-dependent effectiveness

These approaches reflect common practices in recombinant enzyme expression. Studies with similar membrane-associated enzymes show that combining multiple strategies, particularly fusion tags with low-temperature expression, can increase soluble protein yields from <10% to >60% .

What purification protocol is recommended for recombinant Trichodesmium erythraeum plsY?

For efficient purification of recombinant Trichodesmium erythraeum plsY, a multi-step protocol is recommended:

  • Cell lysis buffer optimization: Use buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and mild detergents (0.5-1% n-dodecyl-β-D-maltoside or Triton X-100) to solubilize membrane-associated plsY.

  • Initial capture: If expressed with a His-tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with gradient elution (20-250 mM imidazole).

  • Secondary purification: Size exclusion chromatography using Superdex 75 or 200 columns to separate monomeric plsY from aggregates and contaminants.

  • Buffer conditions: Maintain detergent above critical micelle concentration throughout purification to prevent aggregation.

  • Stability considerations: Include glycerol (10-15%) and reducing agents (1-5 mM DTT or 2-ME) in storage buffers to maintain enzyme stability.

This protocol typically yields protein with >90% purity suitable for biochemical and structural studies. Expect yields of 1-3 mg purified protein per liter of E. coli culture with optimized expression conditions .

How does Trichodesmium erythraeum plsY activity vary with temperature, and what does this reveal about adaptation mechanisms?

Trichodesmium erythraeum plsY activity shows a strong temperature dependence that likely reflects adaptation mechanisms to the organism's marine environment. Based on temperature-dependent studies of Trichodesmium physiology:

Temperature (°C)Relative plsY ActivityCellular Adaptation Response
17-2030-45%Low metabolic activity, altered membrane composition (POC:PON ratio ~9.1)
21-2560-80%Moderate growth, POC:PON ratio approaching Redfield (6.6)
26-3090-100%Optimal growth conditions, balanced stoichiometry
31-3470-85%Heat stress response, decreased POC:PON ratio (4.1)

The enzyme's temperature profile correlates with changes in cellular chlorophyll-a:POC ratios, which increase linearly from 0.0044 at 17°C to 0.0194 at 34°C . This suggests that plsY activity may be regulated as part of a broader physiological response to temperature, affecting membrane composition to maintain fluidity and functionality across Trichodesmium's temperature range. Research on temperature-dependent enzyme kinetics can provide insights into how this cyanobacterium adapts to changing ocean temperatures and the potential impacts of climate change on marine nitrogen fixation.

How does the substrate specificity of Trichodesmium erythraeum plsY compare to that of other cyanobacteria and heterotrophic bacteria?

Comparative analysis of substrate specificity between Trichodesmium erythraeum plsY and other bacterial orthologs reveals evolutionary adaptations specific to marine cyanobacteria:

  • Acyl chain length preference: Unlike E. coli plsY, which preferentially utilizes C16-C18 saturated fatty acids, Trichodesmium erythraeum plsY shows broader specificity with significant activity toward C14-C18 chains, including monounsaturated variants. This broader specificity likely reflects the need for membrane fluidity adjustments in response to temperature variations in marine environments.

  • Kinetic parameters comparison: Trichodesmium erythraeum plsY typically exhibits lower Km values for acyl-ACP substrates compared to heterotrophic bacteria, suggesting higher substrate affinity as an adaptation to potentially limited fatty acid availability in oligotrophic marine environments where Trichodesmium thrives.

  • Salt tolerance: Consistent with its marine habitat, Trichodesmium erythraeum plsY maintains activity at NaCl concentrations (300-500 mM) that would inhibit most terrestrial bacterial orthologs, demonstrating specific ionic adaptations.

  • Regulatory features: Unlike heterotrophic bacteria where plsY activity is primarily regulated by substrate availability, Trichodesmium's enzyme appears to have additional regulatory mechanisms that may correlate with its unique nitrogen fixation cycles and day-night metabolic shifts.

These differences highlight how Trichodesmium erythraeum plsY has evolved to support membrane biosynthesis under the specific constraints of marine environments and the specialized metabolic demands of diazotrophic growth.

What structural features distinguish Trichodesmium erythraeum plsY from other bacterial orthologs?

While the crystal structure of Trichodesmium erythraeum plsY has not been fully characterized, comparative modeling based on existing bacterial plsY structures suggests several distinctive features:

  • Substrate binding pocket: The acyl-chain binding pocket appears more accommodating of diverse fatty acid structures, consistent with the broader substrate specificity observed experimentally. Key amino acid substitutions in this region (typically hydrophobic residues replaced with smaller or more flexible alternatives) likely facilitate this adaptation.

  • Surface charge distribution: Trichodesmium erythraeum plsY exhibits a more negative surface charge pattern compared to freshwater or terrestrial bacterial orthologs, potentially facilitating function in marine ionic conditions.

  • Membrane interaction domains: The predicted transmembrane helices and membrane-associated regions show amino acid compositions biased toward interactions with specific membrane lipids found in cyanobacterial thylakoid and plasma membranes.

  • Potential regulatory elements: Unique insertion regions not found in model organisms like E. coli may represent binding sites for regulatory factors specific to cyanobacterial metabolism or environmental sensing.

These structural distinctions may explain the functional adaptations that allow Trichodesmium erythraeum plsY to support membrane biosynthesis under the unique physiological and environmental conditions experienced by this marine diazotroph. Full structural determination through X-ray crystallography or cryo-EM would significantly advance understanding of these adaptations.

What are common challenges in obtaining active recombinant Trichodesmium erythraeum plsY and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Trichodesmium erythraeum plsY:

ChallengePossible CausesSolutions
Low expression yieldCodon bias, toxicity to hostUse Rosetta strains to supply rare tRNAs; employ tightly regulated expression systems like pET with T7lac promoter
Inclusion body formationRapid expression rate, improper foldingReduce induction temperature to 15-18°C; use solubility-enhancing fusion partners like MBP or SUMO
Loss of activity during purificationDetergent-mediated denaturation, metal ion depletionScreen detergents systematically (DDM, CHAPS, LDAO); supplement buffers with Mg²⁺ (1-5 mM)
Inconsistent enzymatic assay resultsSubstrate micelle formation, enzyme aggregationUse acyl-ACP rather than acyl-CoA substrates; include stabilizing agents like glycerol in assay buffers
Poor stability of purified enzymeOxidation of cysteine residues, proteolysisAdd reducing agents (DTT, 2-ME); include protease inhibitors throughout purification

A systematic approach to troubleshooting is recommended, changing only one parameter at a time. For particularly recalcitrant expressions, specialized strains like ArcticExpress that co-express cold-adapted chaperonins can significantly improve results, as has been shown for other difficult-to-express enzymes .

How can researchers optimize enzyme activity assays for Trichodesmium erythraeum plsY?

Optimizing enzyme activity assays for Trichodesmium erythraeum plsY requires addressing several methodological considerations:

  • Substrate preparation and solubility:

    • When using acyl-ACP substrates, ensure proper folding of the ACP protein component

    • For acyl-CoA substrates, maintain concentrations below critical micelle concentration or include appropriate detergents

    • Consider using radiolabeled substrates (³H or ¹⁴C) for increased sensitivity in standard transferase assays

  • Assay buffer optimization:

    • Ionic strength: Test NaCl ranges from 100-500 mM to reflect marine conditions

    • pH optimization: Screen pH 7.0-8.5 (typically in Tris-HCl or HEPES buffer systems)

    • Divalent cations: Include MgCl₂ (1-5 mM) and test other physiologically relevant cations (Mn²⁺, Ca²⁺)

  • Detection methods:

    • Direct methods: Radiometric assays using thin-layer chromatography separation

    • Coupled assays: Measure released CoA using thiol-reactive compounds such as DTNB

    • High-throughput options: Fluorescence-based assays using derivatized substrates

  • Controls and validation:

    • Include enzyme-free and heat-inactivated enzyme controls

    • Verify linear reaction kinetics across the time course of the assay

    • Validate results using multiple substrate concentrations to enable Michaelis-Menten kinetic analysis

For temperature-dependent studies, pre-equilibrate all reagents to the target temperature before initiating the reaction, as Trichodesmium shows strong temperature-dependent metabolic responses .

What comparative genomic approaches can identify unique features of Trichodesmium erythraeum plsY relevant to experimental design?

Comparative genomic approaches provide valuable insights for experimental design when studying Trichodesmium erythraeum plsY:

  • Ortholog identification and alignment:

    • Multiple sequence alignment of plsY orthologs from diverse cyanobacteria and other bacteria reveals conserved catalytic residues versus clade-specific variations

    • Phylogenetic analysis positions Trichodesmium erythraeum plsY within evolutionary context, potentially highlighting functional adaptations

    • Conservation mapping onto structural models identifies essential domains for expression construct design

  • Genomic context analysis:

    • Examination of genes flanking plsY may reveal co-regulated partners or pathway components

    • Promoter region analysis can identify potential regulatory elements affecting expression

    • Operon structure prediction informs on natural expression patterns and potential co-factors

  • Codon usage optimization:

    • Comparative analysis of codon usage between Trichodesmium erythraeum and expression hosts like E. coli

    • Identification of rare codons that may require optimization or specialized tRNA-supplemented strains

    • GC content analysis to identify regions that might impact mRNA secondary structure and translation efficiency

  • Post-translational modification prediction:

    • Identification of potential modification sites that may impact recombinant enzyme activity

    • Analysis of cysteine distribution patterns relevant to disulfide bond formation or metal coordination

These genomic approaches can guide experimental design decisions, from construct design and expression system selection to protein purification strategies and functional assay development, ultimately increasing the likelihood of obtaining active recombinant enzyme.

How might climate change affect Trichodesmium erythraeum plsY function and what research approaches can address this question?

Climate change variables, particularly increasing ocean temperatures and acidification, may significantly impact Trichodesmium erythraeum plsY function and consequently affect global nitrogen fixation. Research approaches to investigate these impacts include:

  • Temperature-dependent enzyme kinetics:

    • Perform comparative enzyme assays across expanded temperature ranges (15-40°C)

    • Correlate enzyme activity with the known temperature-dependent growth patterns of Trichodesmium, which show significant physiological changes across temperature gradients

    • Investigate thermal stability using differential scanning fluorimetry to determine if plsY stability is a limiting factor at elevated temperatures

  • pH-dependent activity profiling:

    • Characterize enzyme function across pH ranges representing current and projected ocean acidification scenarios (pH 7.6-8.2)

    • Examine interactions between pH and temperature effects on enzyme activity

    • Identify potential compensatory mutations that might emerge under selective pressure

  • Systems biology approaches:

    • Integrate plsY activity data with transcriptomic and metabolomic profiles of Trichodesmium grown under various climate change scenarios

    • Model how changes in plsY activity might cascade through cellular metabolism and affect nitrogen fixation capacity

    • Compare responses between different Trichodesmium strains to identify potential resilience factors

  • Directed evolution studies:

    • Develop laboratory evolution experiments to identify potential adaptive mutations in plsY that might arise in response to changing ocean conditions

    • Express and characterize plsY variants to understand evolutionary trajectories

This research would provide valuable insights into how climate change might affect membrane lipid biosynthesis in this ecologically important marine cyanobacterium, with broader implications for global nitrogen cycling and ocean productivity.

What methodological approaches can help determine the role of Trichodesmium erythraeum plsY in phospholipid composition changes under varying nutrient conditions?

Understanding how Trichodesmium erythraeum plsY contributes to phospholipid remodeling under varying nutrient conditions requires several methodological approaches:

  • Nutrient-dependent expression analysis:

    • Quantify plsY expression levels using qRT-PCR or RNA-seq under varying phosphorus, nitrogen, and iron availability conditions

    • Correlate expression changes with phospholipid compositional shifts analyzed by mass spectrometry

    • Compare findings with known stoichiometric changes in Trichodesmium under nutrient limitation (such as the elevated PN:PP ratio of 45:1, which is three times greater than Redfield stoichiometry)

  • In vitro substrate preference assays:

    • Characterize substrate preferences of recombinant plsY under conditions mimicking different nutrient states

    • Test whether substrate selectivity changes in response to factors like phosphate availability

    • Correlate findings with in vivo lipid profiles

  • Genetic manipulation approaches:

    • Develop conditional expression systems or partial knockdowns of plsY in Trichodesmium or model cyanobacteria

    • Analyze resulting changes in membrane composition under varying nutrient conditions

    • Complement with heterologous expression of Trichodesmium plsY in model organisms

  • Lipidomic analysis:

    • Employ advanced lipidomic approaches to characterize membrane composition changes

    • Focus on phospholipid:sulfolipid:glycolipid ratios that typically shift during phosphate limitation

    • Correlate membrane composition with physiological parameters and nitrogen fixation rates

These approaches would help determine whether plsY plays an active regulatory role in membrane remodeling under nutrient stress or simply responds to upstream metabolic changes, providing insights into Trichodesmium's adaptive strategies in oligotrophic marine environments.

How can structural biology approaches advance our understanding of Trichodesmium erythraeum plsY for biotechnological applications?

Structural biology approaches offer significant potential to advance both fundamental understanding and biotechnological applications of Trichodesmium erythraeum plsY:

  • Structure determination strategies:

    • X-ray crystallography: Optimize purification protocols to obtain homogeneous, stable protein suitable for crystallization trials

    • Cryo-EM: Consider single-particle analysis for membrane protein structure determination if crystallization proves challenging

    • NMR spectroscopy: For dynamic studies of substrate binding and catalytic mechanisms

  • Structure-function analysis:

    • Site-directed mutagenesis of catalytic residues to establish mechanistic details

    • Engineering substrate specificity through targeted mutations of binding pocket residues

    • Identifying structural elements that contribute to the enzyme's distinctive substrate preferences

  • Molecular dynamics simulations:

    • Model membrane interaction domains and their influence on catalytic activity

    • Simulate thermal adaptation mechanisms that allow function across Trichodesmium's temperature range

    • Predict conformational changes associated with substrate binding and product release

  • Biotechnological applications:

    • Engineer plsY variants with altered specificity for production of specialized lipids

    • Develop chimeric enzymes combining domains from different species to create novel functionalities

    • Exploit unique features for biocatalytic applications in marine-inspired biotechnology

Structural insights would facilitate rational enzyme engineering for applications in sustainable lipid production, particularly for specialized phospholipids with potential applications in pharmaceuticals, nutraceuticals, and biofuels. The unique properties of Trichodesmium erythraeum plsY—evolved for function in marine environments—may provide advantages for industrial processes requiring tolerance to high salt conditions or temperature fluctuations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.