Recombinant Trichodesmium erythraeum NAD (P)H-quinone oxidoreductase subunit 3 (ndhC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Trichodesmium erythraeum NAD(P)H-quinone Oxidoreductase Subunit 3 (ndhC)

Recombinant Trichodesmium erythraeum NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a recombinant protein derived from the cyanobacterium Trichodesmium erythraeum. This protein is part of the NAD(P)H-quinone oxidoreductase complex, which plays a crucial role in electron transfer processes, particularly in photosynthetic and respiratory chains. The ndhC subunit is involved in shuttling electrons from NAD(P)H to quinones via flavin mononucleotide (FMN) and iron-sulfur (Fe-S) centers .

Biological Function and Significance

NAD(P)H-quinone oxidoreductases are essential enzymes in both photosynthetic and respiratory electron transport chains. They facilitate the transfer of electrons from NAD(P)H to quinones, which is crucial for energy production and redox balance within cells. The ndhC subunit, specifically, is part of the NDH-1 complex in chloroplasts, which is involved in cyclic electron flow around photosystem I, contributing to the generation of ATP without net electron transport .

Biochemical Characteristics:

  • Protein Sequence: The sequence includes conserved motifs essential for electron transfer.

  • Cofactors: Contains FMN and iron-sulfur centers.

  • Function: Involved in electron transfer from NAD(P)H to quinones.

Research Applications:

  • Photosynthesis Efficiency: Understanding electron transport mechanisms can help improve photosynthetic efficiency.

  • Bioenergy Systems: Insights into energy production pathways could inform the development of novel bioenergy systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. Please indicate your desired tag type for preferential development.
Synonyms
ndhC; Tery_3501; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Trichodesmium erythraeum (strain IMS101)
Target Names
ndhC
Target Protein Sequence
MFNRESYLLRKYRLIVFFLSGYEYFLGFLMISSLVPIIALTASKLLRPKTRGPERRTTYE SGVEPIGGAWIQFNIRYYMFALVFVIFDVETVFLYPWAVAFHQLGLLAFIEALIFIAILV VALVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from an unidentified electron donor, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory and/or photosynthetic chains. In this organism, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient. Cyanobacterial NDH-1 also contributes to inorganic carbon concentration.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of ndhC in Trichodesmium erythraeum?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a critical component of the photosynthetic and respiratory electron transport chain in Trichodesmium erythraeum. This protein subunit forms part of the NDH-1 complex (NADH dehydrogenase-like complex 1) that facilitates electron transfer from NAD(P)H to plastoquinone. In Trichodesmium, this process is particularly important because it supports both photosynthesis and nitrogen fixation, allowing the organism to fix carbon and nitrogen simultaneously. The electron transport associated with photosynthesis and respiration in Trichodesmium is directly linked to its dinitrogen (N2) fixation and dihydrogen (H2) production capabilities .

How does ndhC contribute to nitrogen fixation in Trichodesmium erythraeum?

The ndhC subunit plays an indirect but crucial role in supporting nitrogen fixation by contributing to cellular energy metabolism. Nitrogen fixation in Trichodesmium requires substantial energy input, primarily in the form of ATP and reducing equivalents. The NDH-1 complex containing ndhC participates in generating the proton motive force necessary for ATP synthesis and helps maintain the redox balance required for nitrogenase activity. Research has shown that Trichodesmium's unique ability to fix nitrogen is dependent on efficient electron transport systems, with the ratio of H2 produced to N2 fixed being controlled by light intensity and spectral composition, suggesting tight coupling between photosynthetic electron transport and nitrogen fixation processes .

Why is studying recombinant ndhC from Trichodesmium erythraeum important for marine ecology research?

Studying recombinant ndhC from Trichodesmium erythraeum provides insights into how this globally important marine cyanobacterium manages its energy requirements while fixing nitrogen in oligotrophic oceans. Trichodesmium is a major contributor to "new" nitrogen input in tropical and subtropical seas, supporting primary productivity of non-diazotrophic organisms. Understanding the molecular mechanisms of its electron transport components helps explain how it sustains nitrogen fixation under varying environmental conditions and how it provides nitrogen sources to other phytoplankton in marine ecosystems . For instance, research has demonstrated that Trichodesmium can release fixed nitrogen in forms including ammonia, urea, and other dissolved organic nitrogen (DON) compounds that support the growth of other marine microorganisms like Synechococcus .

What are the optimal conditions for expressing recombinant Trichodesmium erythraeum ndhC in heterologous systems?

For optimal expression of recombinant Trichodesmium erythraeum ndhC, consider the following methodological approach:

  • Expression system selection: E. coli BL21(DE3) strains are typically suitable for initial trials, as they lack certain proteases and contain the T7 RNA polymerase needed for high-level expression.

  • Codon optimization: Trichodesmium genes often contain rare codons not commonly used in E. coli. Codon optimization of the ndhC sequence for E. coli is essential to improve expression efficiency.

  • Vector design: Use expression vectors containing strong inducible promoters (like T7 or tac) and appropriate fusion tags (like His6 or MBP) to facilitate purification.

  • Growth conditions: Cultivate transformed E. coli at 30°C rather than 37°C to reduce inclusion body formation. Induce expression when culture reaches mid-log phase (OD600 of 0.6-0.8).

  • Induction parameters: Use lower concentrations of IPTG (0.1-0.5 mM) and extend induction time (16-20 hours) to enhance soluble protein yield.
    Since ndhC is a membrane protein, additional considerations include using specialized E. coli strains designed for membrane protein expression (such as C41/C43) and incorporating membrane-mimicking environments during purification.

How can researchers effectively isolate functional ndhC protein from Trichodesmium cultures?

Isolation of functional ndhC protein directly from Trichodesmium cultures requires careful consideration of the organism's growth characteristics and protein stability. The following methodological approach is recommended:

  • Culture preparation: Grow Trichodesmium erythraeum IMS101 in nitrogen-free YBC-II medium under a 12:12 L:D photoperiod at 26°C with appropriate light intensity (70-100 μmol photons m^-2 s^-1) .

  • Cell harvesting: Collect cells during exponential growth phase (typically 7-12 days after inoculation) by gentle filtration onto polycarbonate membranes.

  • Cell disruption: Use gentle mechanical disruption methods like glass bead beating in buffer containing 50 mM HEPES (pH 7.5), 10 mM MgCl2, 5 mM CaCl2, 10% glycerol, and protease inhibitors.

  • Membrane fraction isolation: Separate the membrane fraction by differential centrifugation (low-speed centrifugation to remove cell debris, followed by ultracentrifugation at 100,000 × g to collect membranes).

  • Solubilization: Solubilize membrane proteins using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration.

  • Affinity chromatography: If antibodies against ndhC are available, immunoaffinity chromatography can be used for specific isolation.
    The effectiveness of protein isolation should be verified by Western blotting and activity assays measuring NAD(P)H-dependent electron transport.

What controls should be included when measuring electron transport activity of recombinant ndhC?

When measuring electron transport activity of recombinant ndhC, the following controls are essential to ensure valid and reproducible results:

  • Negative controls:

    • Heat-denatured ndhC protein to confirm activity loss

    • Reaction mixture without ndhC to establish baseline activity

    • Reaction with inhibitors specific to NDH-1 complex (e.g., rotenone)

  • Positive controls:

    • Commercial NDH complex from related cyanobacteria

    • Native membrane fractions from Trichodesmium with intact NDH-1 complex

  • Substrate controls:

    • Test both NADH and NADPH as electron donors to determine specificity

    • Use alternative quinone acceptors to establish electron transfer preferences

  • Assay validation:

    • Include time-course measurements to ensure linearity of the reaction

    • Perform activity assays at various protein concentrations to confirm proportionality

  • Environmental parameter controls:

    • Test activity across a pH range (pH 6.5-8.5)

    • Examine salt concentration effects (50-500 mM NaCl)

    • Assess temperature dependence (20-35°C)
      For accurate quantification, spectrophotometric assays monitoring NAD(P)H oxidation at 340 nm should be supplemented with direct measurement of quinone reduction.

How does ndhC function relate to the unique capability of Trichodesmium to fix nitrogen and carbon simultaneously?

The relationship between ndhC function and Trichodesmium's simultaneous carbon and nitrogen fixation involves sophisticated energetic coordination:
The NDH-1 complex containing ndhC participates in multiple electron transport pathways that help resolve the fundamental biochemical conflict between oxygen-evolving photosynthesis and oxygen-sensitive nitrogen fixation. In Trichodesmium, this coordination operates through several mechanisms:

  • Cyclic electron flow: ndhC-containing complexes mediate cyclic electron flow around photosystem I, generating ATP without producing oxygen, thus supporting nitrogen fixation while minimizing oxygen accumulation.

  • Respiratory oxygen consumption: The NDH-1 complex participates in respiratory electron transport that consumes oxygen, creating microoxic conditions favorable for nitrogenase activity while maintaining energy production.

  • Redox balance maintenance: By facilitating electron flow from NAD(P)H to the plastoquinone pool, ndhC helps maintain cellular redox balance between the two metabolic processes.
    Research has demonstrated that Trichodesmium adjusts its electron transport kinetics in response to changing light conditions. Under high light intensities, the H2:N2 ratio changes, indicating a shift in electron allocation between photosynthesis and nitrogen fixation . This relationship is further evidenced by observations that nitrogen fixation rates correlate with photosynthetic electron transport rates under varying light conditions.

How can researchers use site-directed mutagenesis of ndhC to investigate electron transport coupling with nitrogen fixation?

Site-directed mutagenesis of ndhC provides a powerful approach to investigate the coupling between electron transport and nitrogen fixation in Trichodesmium. A methodological framework includes:

  • Target residue identification:

    • Conserved residues in quinone-binding regions

    • Residues potentially involved in proton translocation

    • Interface residues that interact with other NDH-1 subunits

  • Mutation design strategy:

    • Conservative substitutions to alter but not abolish function

    • Charge-altering mutations to disrupt electrostatic interactions

    • Introduction of spectroscopic probes for real-time monitoring

  • Functional assessment protocol:

    • Measure electron transport rates using artificial electron acceptors

    • Quantify H2 production and N2 fixation rates simultaneously

    • Determine ATP/NADPH ratios under different light conditions

  • Physiological impact analysis:

    • Monitor growth rates under nitrogen-fixing versus nitrogen-replete conditions

    • Assess transcriptional responses of nitrogen fixation genes (e.g., nifH)

    • Measure nitrogen release to surrounding medium
      This approach has revealed that specific amino acid substitutions in NDH complex subunits can alter the H2:N2 ratio and affect the organism's ability to balance photosynthetic and nitrogen fixation activities. For example, mutations affecting quinone binding can disrupt the electron flow necessary for maintaining redox balance during simultaneous carbon and nitrogen fixation.

What is the relationship between ndhC expression and the nitrogen release mechanisms in Trichodesmium?

The relationship between ndhC expression and nitrogen release mechanisms in Trichodesmium represents an emerging frontier in marine microbial ecology research:
Current evidence suggests that electron transport processes involving ndhC-containing complexes may influence nitrogen release patterns in Trichodesmium through several potential mechanisms:

  • Energy allocation: The NDH-1 complex contributes to cellular energy balance, potentially affecting the proportion of fixed nitrogen that is retained versus released. Research has shown that Trichodesmium can release significant amounts of fixed nitrogen as dissolved organic nitrogen (DON), with urea comprising more than 20% of the total fixed nitrogen released .

  • Redox sensing: NDH-1 complexes may participate in redox sensing that regulates nitrogen metabolism genes, influencing whether fixed nitrogen is assimilated or excreted.

  • Membrane integrity: As a membrane protein complex component, ndhC may indirectly affect membrane properties that regulate nitrogen compound transport across cellular membranes.
    Studies have demonstrated that Trichodesmium cultures release different forms of fixed nitrogen, including ammonia, urea, and other DON compounds, which support the growth of non-diazotrophic cyanobacteria like Synechococcus . This nitrogen release pattern appears to vary with environmental conditions, suggesting regulatory links to electron transport and energy metabolism processes.

What are common challenges in purifying active recombinant ndhC and how can they be addressed?

Purification of active recombinant ndhC presents several challenges due to its hydrophobic nature and role as part of a multi-subunit membrane complex. The following table outlines common challenges and their solutions:

ChallengeCauseSolution
Low expression yieldToxicity to host cellsUse tightly regulated expression systems; lower induction temperature to 18-20°C
Inclusion body formationImproper foldingExpress with fusion partners (MBP, SUMO); use specialized E. coli strains (C41/C43)
Loss of activity during purificationDetergent-induced denaturationScreen multiple detergents (DDM, LMNG, GDN); include lipids during purification
Aggregation after purificationRemoval of stabilizing lipidsAdd phospholipids or use nanodiscs/amphipols as membrane mimetics
Co-purification of host proteinsNon-specific bindingImplement sequential chromatography steps; include imidazole gradient for His-tagged proteins
Lack of interacting partnersIsolation from complexCo-express with adjacent NDH-1 subunits; purify entire subcomplexes
Successful purification often requires an empirical approach, testing various expression conditions and purification protocols. For functional studies, reconstitution into proteoliposomes containing lipids extracted from Trichodesmium membranes can help maintain native-like activity.

How can researchers overcome difficulties in measuring ndhC activity in the context of nitrogen fixation?

Measuring ndhC activity in the context of nitrogen fixation presents unique challenges due to the oxygen sensitivity of nitrogenase and the complex electron flow pathways. Researchers can address these challenges through the following approaches:

  • Oxygen management strategies:

    • Conduct experiments in anaerobic chambers

    • Include oxygen scavenging systems (glucose/glucose oxidase)

    • Use sealed reaction vessels with oxygen sensors

  • Activity coupling measurement techniques:

    • Deploy dual isotope labeling (15N2 and 13CO2) to simultaneously track nitrogen and carbon fixation

    • Implement real-time H2 production measurements as a proxy for electron allocation

    • Use artificial electron donors/acceptors to isolate specific electron transport segments

  • Time-resolved analyses:

    • Synchronize cultures to the natural diel rhythm of nitrogen fixation

    • Perform measurements at defined phases of the light/dark cycle

    • Include sampling at short intervals to capture transient states

  • Inhibitor-based approaches:

    • Apply specific inhibitors of different electron transport segments

    • Use DCMU to block photosystem II, isolating cyclic electron flow

    • Employ partial inhibition to create a range of electron transport rates

  • Genetic complementation strategies:

    • Express wild-type ndhC in mutant backgrounds

    • Create chimeric proteins with segments from different species

    • Introduce tagged versions for activity and localization studies
      These methods have successfully demonstrated the connection between electron transport activities and nitrogen fixation rates. For example, studies have shown that under different light intensities, Trichodesmium adjusts its electron allocation between carbon fixation, nitrogen fixation, and hydrogen production, with corresponding changes in the H2:N2 ratio .

What experimental considerations are important when studying ndhC interactions with other components of the electron transport chain?

When investigating ndhC interactions with other components of the electron transport chain, several critical experimental considerations must be addressed:

  • Native complex preservation:

    • Use gentle solubilization conditions (0.5-1% digitonin or mild non-ionic detergents)

    • Implement rapid purification at low temperatures (4°C)

    • Include stabilizing agents (glycerol, specific lipids) throughout purification

  • Interaction detection methods selection:

    • For transient interactions: Chemical cross-linking coupled with mass spectrometry

    • For stable interactions: Blue native PAGE followed by Western blotting

    • For in vivo interactions: Split-fluorescent protein complementation assays

  • Reconstitution strategy development:

    • Screen lipid compositions mimicking Trichodesmium membranes

    • Test various protein:lipid ratios to optimize complex formation

    • Include specific cofactors required for functional assembly

  • Functional validation approaches:

    • Measure electron transfer rates under physiologically relevant conditions

    • Compare activities between isolated components and reconstituted complexes

    • Assess the impact of mutations at putative interaction interfaces

  • Structural analysis considerations:

    • Use negative-stain electron microscopy for initial complex characterization

    • Apply cryo-electron microscopy for higher-resolution structural analysis

    • Complement with computational modeling of interaction surfaces
      Research has shown that in cyanobacteria, the NDH-1 complex containing ndhC interacts with multiple electron transport components, influencing the balance between cyclic and linear electron flow. These interactions are particularly important in Trichodesmium as they help coordinate the energetic demands of nitrogen fixation with photosynthetic electron transport, allowing this organism to provide nitrogen sources to other marine microorganisms in oligotrophic environments .

How might global climate change impact ndhC function and nitrogen fixation in Trichodesmium populations?

Climate change factors may significantly impact ndhC function and nitrogen fixation in Trichodesmium through several mechanisms:

  • Temperature effects:

    • Rising ocean temperatures may alter the conformation and stability of ndhC and other NDH-1 complex proteins

    • Thermal stress could shift the balance between linear and cyclic electron flow

    • Temperature-dependent changes in membrane fluidity may affect NDH-1 complex assembly and function

  • Ocean acidification impacts:

    • Decreased pH may alter proton gradients maintained by NDH-1 complexes

    • Acidification could affect the redox potential of electron carriers interacting with ndhC

    • Changes in carbonate chemistry may indirectly affect nitrogen fixation through impacts on carbon concentration mechanisms

  • Altered light regimes:

    • Changes in mixed layer depth could modify light availability and spectral quality

    • Light stress may increase reactive oxygen species production, affecting ndhC function

    • Shifts in light intensity could alter the H2:N2 ratio, as observed in laboratory experiments

  • Nutrient availability changes:

    • Shifts in iron or phosphorus availability may affect electron transport chain component synthesis

    • Nutrient limitation might alter the expression patterns of ndhC and related genes

    • Changed nutrient ratios could affect nitrogen release patterns to other organisms
      Current research indicates that Trichodesmium's nitrogen fixation and release mechanisms are sensitive to environmental conditions, with different nitrogen sources (nitrate, ammonium, urea) affecting growth and gene expression differently . Further studies combining molecular approaches with ecosystem-level observations will be crucial for predicting how these globally important nitrogen fixers will respond to changing ocean conditions.

What potential biotechnological applications exist for engineered ndhC variants in sustainable energy research?

Engineered ndhC variants from Trichodesmium present several promising biotechnological applications in sustainable energy research:

  • Biohydrogen production systems:

    • Engineered ndhC variants could enhance electron flux to hydrogenase enzymes

    • Optimized electron transport could improve H2:N2 ratios, favoring hydrogen production

    • Integration into synthetic pathways could create light-driven hydrogen production platforms

  • Photosynthetic efficiency enhancement:

    • Modified ndhC proteins could improve cyclic electron flow, boosting ATP production

    • Engineered variants might reduce photoinhibition through improved alternative electron flow

    • Enhanced NDH-1 complexes could optimize energy balance in engineered photosynthetic systems

  • Biofertilizer development:

    • Engineered strains with modified ndhC could enhance nitrogen fixation and release

    • Optimized electron transport could improve nitrogen fixation efficiency under suboptimal conditions

    • Targeted modifications might increase urea production, which comprises over 20% of released nitrogen

  • Bioremediation applications:

    • Modified electron transport properties could enhance tolerance to pollutants

    • Engineered strains might better persist in contaminated environments while providing fixed nitrogen

    • Integration into microbial consortia could support bioremediation in nitrogen-limited settings

  • Biosensor technologies:

    • ndhC variants could be developed as redox-sensitive biosensor components

    • Electron transport alterations could provide measurable signals in response to environmental changes

    • Integration with reporting systems could enable monitoring of ocean conditions
      These applications build on the natural capabilities of Trichodesmium to fix nitrogen and carbon simultaneously while managing electron flow through complexes containing ndhC. The organism's ability to support surrounding microorganisms through nitrogen release provides a model for engineered systems aimed at supporting sustainable biological processes.

How might emerging techniques in structural biology advance our understanding of ndhC function in nitrogen-fixing cyanobacteria?

Emerging structural biology techniques offer unprecedented opportunities to advance our understanding of ndhC function in nitrogen-fixing cyanobacteria:

  • Cryo-electron microscopy advancements:

    • Single-particle cryo-EM now achieves near-atomic resolution of membrane protein complexes

    • Tomographic approaches can visualize NDH-1 complexes in their native membrane environment

    • Time-resolved cryo-EM might capture different conformational states during electron transport

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, and computational modeling with cryo-EM data

    • Cross-linking mass spectrometry to map interaction surfaces between ndhC and other subunits

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions important for function

  • In situ structural techniques:

    • Cellular cryo-electron tomography to visualize NDH-1 complexes within intact Trichodesmium cells

    • Correlative light and electron microscopy to connect structure with function in living cells

    • Super-resolution microscopy to track dynamic assembly of complexes containing ndhC

  • Time-resolved methods:

    • Serial femtosecond crystallography at X-ray free electron lasers to capture electron transfer events

    • Time-resolved spectroscopy coupled with structural data to connect conformational changes with function

    • Molecular dynamics simulations based on structures to model electron and proton transfer pathways

  • Structure-guided functional studies:

    • CRISPR-based precise genome editing informed by structural insights

    • Structure-based design of variants with altered electron transfer properties

    • Computational prediction of interaction networks based on structural data
      These approaches would significantly enhance our understanding of how ndhC functions within the NDH-1 complex to support the unique capability of Trichodesmium to simultaneously fix carbon and nitrogen. Such insights could help explain how Trichodesmium maintains efficient electron transport while providing nitrogen sources like urea and ammonia to surrounding marine organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.