Recombinant Trichodesmium erythraeum NAD (P)H-quinone oxidoreductase subunit L (ndhL)

Shipped with Ice Packs
In Stock

Description

Role in the NDH-1 Complex

The NDH-1 complex in Trichodesmium facilitates electron transfer from NAD(P)H to quinones, coupling this process to proton translocation across membranes. In T. erythraeum, this enzyme is pivotal for:

  • Respiratory metabolism: Maintaining redox balance and ATP synthesis .

  • Nitrogen fixation: Regulating intracellular oxygen levels to protect nitrogenase activity, as Trichodesmium lacks heterocysts .

Expression and Purification

Recombinant ndhL is synthesized in multiple systems:

Host SystemPurityTagSource
E. coli≥85%N-terminal His
Yeast/Baculovirus≥85%Unspecified
Cell-free expression≥85%None

Key challenges include maintaining proper folding and solubility, often addressed by optimizing buffer conditions (e.g., Tris-based buffers with glycerol) .

Functional Studies

  • Iron limitation: In T. erythraeum, iron scarcity downregulates nifH (nitrogenase) and photosynthetic genes, indirectly affecting NDH-1 activity .

  • Oxygen regulation: Computational models propose that NDH-1-mediated Mehler reactions reduce intracellular oxygen, enabling simultaneous carbon and nitrogen fixation .

Applications in Research

  • ELISA assays: Used to quantify ndhL expression in environmental or experimental samples .

  • Structural studies: Recombinant ndhL aids in elucidating subunit interactions within the NDH-1 complex .

  • Biotechnology: Potential role in bioengineered systems for hydrogen production or redox-driven processes .

Comparative Analysis of ndhL Across Organisms

OrganismndhL SequenceHost SystemFunction
T. erythraeumPartial (1–78 aa)E. coliRespiratory electron transport
SynechococcusPartialE. coliPhotosynthetic electron transport
ProchlorococcusPartialE. coliQuinone reduction in phototrophy

Challenges and Future Directions

  • Mechanistic gaps: The precise role of ndhL in oxygen regulation during nitrogen fixation remains unclear .

  • Thermodynamic optimization: T. erythraeum thrives in warm (20–34°C) oligotrophic waters, but recombinant ndhL stability at elevated temperatures is unstudied .

  • Translational potential: Leveraging ndhL in synthetic biology for biofuel production or bioremediation requires further exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhL; Tery_4495; NAD(PH-quinone oxidoreductase subunit L; NAD(PH dehydrogenase I subunit L; NDH-1 subunit L; NDH-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-78
Protein Length
full length protein
Species
Trichodesmium erythraeum (strain IMS101)
Target Names
ndhL
Target Protein Sequence
MNLDLDTNLIILIIYAALAGAYFLVMPAIVYAYLKTRWYVVSSIERVFMYFLMFLFFPGM LVLSPFLNFRPRKQQIES
Uniprot No.

Target Background

Function
NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. It couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.
Database Links
Protein Families
Complex I NdhL subunit family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.