Recombinant Trichodesmium erythraeum Photosystem Q (B) protein 2 (psbA3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

This recombinant protein is synthesized using E. coli expression systems, optimized for high yield and stability:

ParameterSpecification
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE) ; ≥85% in some commercial batches
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Reconstitution protocols recommend dissolving the protein in sterile water (0.1–1.0 mg/mL) and adding glycerol (5–50%) for long-term storage at -80°C .

Biochemical Stability

Storage and handling guidelines ensure functional integrity:

ConditionRecommendation
Short-term Storage4°C (up to one week)
Long-term Storage-20°C/-80°C in aliquots to avoid freeze-thaw cycles
Stability EnhancersGlycerol (prevents aggregation); trehalose (lyoprotectant)

Functional and Research Applications

This recombinant protein is primarily used to:

  • Study PSII structure-function relationships under varying environmental conditions .

  • Investigate D1 protein turnover and photodamage repair mechanisms .

  • Develop inhibitors targeting photosynthetic electron transport (e.g., herbicides) .

Comparative Homologs

psbA3 homologs exist in other cyanobacteria, with functional variations:

SpeciesProtein NameKey Differences
Thermosynechococcus elongatusPhotosystem Q(B) protein 3Thermostability adaptations
Synechococcus sp.Photosystem II D1 protein 3Distinct regulatory regions

Limitations and Future Directions

  • Knowledge Gaps: Structural dynamics of T. erythraeum D1 under high-light or oxidative stress are poorly characterized.

  • Technical Challenges: Low solubility without detergents or glycerol .

  • Research Opportunities: CRISPR-edited T. erythraeum strains could clarify psbA3’s role in marine nitrogen fixation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
psbA3; Tery_4763; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Trichodesmium erythraeum (strain IMS101)
Target Names
psbA3
Target Protein Sequence
MTTTLQQRENANVWERFCSWVTSTDNRIYVGWFGVLMIPTLLTATICYIIAFVAAPPVDI DGIREPVAGSLMFGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL IGIFTYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTALGVSTMAFNLNGF NFNQSIIDSSGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.