Recombinant Trichodesmium erythraeum UPF0754 membrane protein Tery_3973, also known as Tery_3973, is a protein derived from the cyanobacterium Trichodesmium erythraeum . Trichodesmium erythraeum is a marine cyanobacterium known for its ability to fix nitrogen and its significant role in marine ecosystems . Tery_3973 is a UPF0754 membrane protein with unknown function .
Tery_3973 is expressed in E. coli and tagged with N-terminal His for purification purposes . The protein's molecular weight is approximately 46.2 kDa . The protein is stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . It is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the option to add 5-50% glycerol for long-term storage at -20°C/-80°C .
The amino acid sequence of Tery_3973 is:
MSNIWLYFVPPIAGGIIGYFTNDIAIKMLFRPYRPYYIFRRKLPFTPGLIPANQERLAKRVADTIMGSLLTPSELQNLARRLLQTERMEAAILWLLQMSLDQLKLNTDTKSTKILANILRDLLGQSLPRLLKVWAKREYFLEAQINQIFDQILLEFQLTEIQAAQLSDWLLKVVVPPDVL
RKTLIDFLTDQNISIIDEGFREKASGTYWVVANLFGLRNTLTRLRTFCLDERDLTNQRLMELITALAVKERITEWLHSLSMQNLPVSTVRELRNTMQNSVRLYLQENGTDLIQALSLSVAWEHIADLIINRLQASSIMNSSLELVSRELALILERYLERDLENIVALAIPILNIDQVIID
RIKGT
The precise function of Tery_3973 is currently unknown, but it is annotated as a UPF0754 membrane protein . UPF0754 proteins are a family of proteins with largely uncharacterized functions . Membrane proteins are involved in various cellular processes, including transport, signaling, and maintaining cell structure . Further research is needed to elucidate the specific role of Tery_3973 in Trichodesmium erythraeum .
Studies combining transcriptomics and proteomics have provided insights into the expression patterns of genes and proteins in Trichodesmium erythraeum under different environmental conditions, such as phosphorus deficiency . While the study does not directly mention Tery_3973, it highlights the importance of integrating transcriptome and proteome data to understand the physiological responses of Trichodesmium erythraeum .
KEGG: ter:Tery_3973
STRING: 203124.Tery_3973
Tery_3973 is a full-length membrane protein (408 amino acids) from the marine cyanobacterium Trichodesmium erythraeum. It belongs to the UPF0754 protein family, a group of uncharacterized membrane proteins. The protein has been successfully expressed as a recombinant protein with an N-terminal His tag in E. coli expression systems . Trichodesmium erythraeum plays critical roles in global carbon and nitrogen cycles, and understanding its membrane proteins is essential for elucidating how these organisms adapt to their marine environments .
The protein's membrane localization suggests it may be involved in transport or signaling functions, potentially relating to the organism's response to environmental stressors such as iron limitation. While the specific function remains to be fully characterized, its conservation across Trichodesmium species indicates evolutionary importance .
Recombinant Tery_3973 is typically expressed in E. coli expression systems with an N-terminal His tag to facilitate purification. The methodological approach involves several key steps:
Vector construction: The gene encoding Tery_3973 is cloned into an expression vector with an N-terminal His tag.
Expression conditions: Transformation into an appropriate E. coli strain, followed by culture in media optimized for membrane protein expression.
Induction: Expression is typically induced with IPTG at optimal temperature and duration.
Cell harvest and lysis: Bacterial cells are harvested by centrifugation and disrupted by methods such as sonication or French press.
Membrane fraction isolation: Differential centrifugation to separate the membrane fraction.
Solubilization: Membrane proteins require detergents for solubilization; common choices include n-dodecyl β-D-maltoside (DDM) or Triton X-100.
Affinity purification: His-tagged protein is purified using Ni-NTA or similar affinity resins.
Quality control: SDS-PAGE and Western blotting to verify purity and identity .
For membrane proteins like Tery_3973, optimization of detergent conditions is crucial for maintaining protein stability and native conformation during purification.
Based on established protocols for similar membrane proteins, the optimal storage conditions for recombinant Tery_3973 include:
Buffer composition: Tris/PBS-based buffer at pH 8.0, containing 6% trehalose as a stabilizing agent .
Temperature: Store at -20°C to -80°C for long-term storage, with -80°C preferred for extended periods .
Aliquoting: Divide the purified protein into small single-use aliquots to avoid repeated freeze-thaw cycles, which can compromise protein integrity .
Glycerol addition: Addition of glycerol (typically 5-50% final concentration) helps prevent freeze damage and maintain protein stability during storage .
Reconstitution: When needed, reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .
It is strongly recommended to avoid repeated freeze-thaw cycles, and working aliquots can be maintained at 4°C for up to one week to minimize degradation .
Trichodesmium erythraeum plays fundamental roles in marine ecosystems, particularly in global biogeochemical cycles:
Nitrogen fixation: As a diazotrophic cyanobacterium, T. erythraeum converts atmospheric N₂ into biologically available nitrogen forms, significantly contributing to marine primary productivity in nutrient-limited waters .
Carbon cycling: Through photosynthesis and nitrogen fixation, it contributes substantially to carbon fixation in oligotrophic ocean regions .
Bloom formation: Forms extensive blooms ("sea sawdust") visible from space, affecting marine nutrient dynamics across large areas.
Climate interaction: The nitrogen and carbon cycling activities of Trichodesmium have implications for global climate models and carbon sequestration.
Ecological adaptations: T. erythraeum has evolved specialized mechanisms to thrive in nutrient-limited environments, including sophisticated responses to iron limitation, as iron is a critical cofactor for the nitrogenase enzyme complex .
Understanding Tery_3973 and similar proteins may provide insights into how these organisms adapt to their ecological niches, particularly in response to trace metal availability which constrains nitrogen fixation rates .
For optimal expression of recombinant Tery_3973, researchers should consider these methodological approaches:
Codon optimization: Adapting the gene sequence to E. coli codon usage, especially considering that cyanobacterial genes often contain rare codons.
Temperature modulation: Lower temperatures (16-20°C) during induction to slow protein production and improve folding.
Induction optimization: Testing various IPTG concentrations and induction durations.
Media supplementation: Addition of iron and other trace elements relevant to the protein's native environment .
When designing expression experiments, implementing a factorial design approach allows systematic identification of optimal conditions while minimizing experimental runs .
Optimizing solubility for membrane proteins like Tery_3973 requires careful consideration of multiple factors:
Fusion partners: Consider using solubility-enhancing fusion partners such as MBP (maltose-binding protein), SUMO, or Thioredoxin at the N-terminus.
Detergent screening: Systematic testing of different detergents is critical:
| Detergent Class | Examples | Recommended Concentration | Best For |
|---|---|---|---|
| Mild non-ionic | DDM, DM, OG | 1-2× CMC | Initial extraction |
| Zwitterionic | LDAO, Fos-Choline | 2-5× CMC | Higher stringency |
| Steroid-based | Digitonin, CHAPS | 0.5-1% | Native complex preservation |
| Neopentyl glycol | LMNG, UDM | 0.01-0.05% | Long-term stability |
Lipid supplementation: Addition of E. coli polar lipids (0.01-0.1 mg/mL) or specific phospholipids can stabilize membrane proteins.
Buffer optimization:
Extraction conditions: Gentle solubilization with moderate detergent concentrations over extended periods (e.g., 2-4 hours) at 4°C.
Purification design: Implement a multi-step purification strategy with carefully controlled detergent exchange during each step .
Given that Tery_3973 has been successfully prepared as a lyophilized powder, researchers should note that the reconstitution process is equally important, using deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL .
When designing functional assays for Tery_3973, comprehensive controls ensure experimental validity and interpretable results:
Positive controls:
Well-characterized membrane proteins from the same family
Proteins with known response to iron limitation
Other characterized UPF0754 family proteins (if available)
Negative controls:
Empty vector/expression system
Heat-denatured Tery_3973
Unrelated membrane protein expressed under identical conditions
Experimental validation controls:
Wild-type Trichodesmium erythraeum cells under normal and iron-limited conditions
Mutant strains (if available) with modified expression of Tery_3973
Technical controls:
Detergent-only controls to assess detergent effects on assay systems
Buffer composition controls
Protein concentration gradients to establish dose-response relationships
Specificity controls:
For iron stress response studies specifically, parallel examination of known iron-responsive genes such as isiB, idiA, and feoB provides important contextual information . The experimental design should incorporate both biological and technical replicates with appropriate statistical power to detect physiologically relevant differences .
Based on established approaches for studying iron stress responses in Trichodesmium, a comprehensive experimental design should include:
Growth conditions matrix:
| Iron Concentration | Nitrogen Source | Temperature | Light Intensity | Sampling Points |
|---|---|---|---|---|
| Replete (>10 nM) | N₂ only | Optimal (25-28°C) | 50-100 μmol photons/m²/s | Early, mid, late exponential |
| Limited (1-5 nM) | N₂ only | Optimal (25-28°C) | 50-100 μmol photons/m²/s | Early, mid, late exponential |
| Depleted (<1 nM) | N₂ only | Optimal (25-28°C) | 50-100 μmol photons/m²/s | Early, mid, late exponential |
| Replete (>10 nM) | NO₃⁻ (control) | Optimal (25-28°C) | 50-100 μmol photons/m²/s | Early, mid, late exponential |
Parallel measurements:
Temporal considerations:
Short-term responses (hours)
Acclimation phase (days)
Long-term adaptation (weeks)
Multiple Trichodesmium species/strains:
Statistical design:
This systematic approach allows for identification of correlations between Tery_3973 expression patterns and physiological responses to iron stress, while controlling for confounding variables .
Statistical analysis of Tery_3973 experimental data should be tailored to the experimental design and research questions:
For gene expression studies:
Normalization methods: Use multiple reference genes (minimum 3) tested for stability under experimental conditions
Differential expression: ANOVA with post-hoc tests (Tukey or Dunnett) for multiple comparisons
qPCR data: ΔΔCt method with efficiency correction
Correlation analysis: Pearson or Spearman correlation between Tery_3973 expression and physiological parameters
For protein function assays:
Enzyme kinetics: Non-linear regression for determination of kinetic parameters
Dose-response relationships: Four-parameter logistic regression
Time-course experiments: Repeated measures ANOVA or mixed-effects models
For multi-species/strain comparisons:
For experimental design optimization:
For managing measurement uncertainty:
Researchers should implement appropriate methods for handling missing data and outliers, and report effect sizes alongside p-values to indicate biological significance in addition to statistical significance .
While specific research on Tery_3973's role in iron stress response is limited, analysis should be contextualized within the broader iron stress response framework in Trichodesmium:
Genomic context: Trichodesmium erythraeum contains many archetypical genes involved in prokaryotic iron stress response. Three key genes—isiB, idiA, and feoB—show clear iron stress responses in axenic T. erythraeum (IMS101) .
Comparative expression: Analysis could examine whether Tery_3973 expression patterns correlate with these known iron-responsive genes. Quantitative PCR with gene-specific primers should be performed under varying iron concentrations.
Clade considerations: Iron stress responses appear conserved across both major Trichodesmium clades (T. erythraeum and T. tenue), suggesting evolutionary importance. The conservation patterns of Tery_3973 should be examined across these clades .
Physiological correlations: High expression of iron stress genes corresponds to specific reductions in N₂ fixation rates. Similar correlations could be investigated for Tery_3973 .
Membrane protein function: As a membrane protein, Tery_3973 may function in:
Iron transport or sensing
Signal transduction related to iron availability
Membrane reorganization under stress conditions
Advanced research would benefit from both transcriptomic and proteomic approaches to determine if Tery_3973 is co-regulated with known iron stress response elements, potentially revealing its role in this critical adaptive pathway .
The conservation of Tery_3973 across Trichodesmium species provides valuable insights into its evolutionary and functional importance:
Examining conservation patterns requires:
Based on the pattern observed with other iron stress response genes (isiB, idiA, and feoB) which are well conserved across Trichodesmium species, Tery_3973 may show similar conservation if it plays a role in this critical adaptive pathway . Significant conservation would support the hypothesis that this protein serves an important function in the ecological adaptation of Trichodesmium to oligotrophic ocean environments.
Understanding the structural features of Tery_3973 that facilitate membrane localization requires detailed analysis of its sequence and predicted structure:
Transmembrane domain prediction:
Analysis of the 408-amino acid sequence using multiple topology prediction algorithms (TMHMM, HMMTOP, Phobius) likely reveals multiple transmembrane helices. The hydrophobicity profile and sequence characteristics suggest it is an integral membrane protein rather than a peripheral membrane-associated protein .
Key structural features:
N-terminal signal sequence or membrane targeting sequence
Hydrophobic transmembrane segments
Amphipathic helices at membrane interfaces
Charged residues defining topology (positive-inside rule)
Potential lipid interaction motifs
Post-translational modifications:
Prediction of potential lipidation sites (palmitoylation, myristoylation)
Phosphorylation sites that might regulate membrane association
Structural homology:
While UPF0754 is an uncharacterized protein family, structural predictions using AlphaFold2 or similar tools may reveal structural similarities to characterized membrane proteins, providing functional insights.
Functional domains:
Analysis may reveal signature domains associated with:
Transport functions
Signal transduction
Protein-protein interaction sites
Substrate binding regions
Experimental validation of these predictions would require techniques such as cysteine scanning mutagenesis, fluorescence microscopy of GFP fusion proteins, or protease protection assays to determine topology and membrane insertion mechanisms .
Systematic mutagenesis strategies can provide valuable insights into Tery_3973 function:
Alanine-scanning mutagenesis:
Systematically replace conserved or charged residues with alanine
Target potential functional domains identified through bioinformatics
Evaluate effects on protein expression, localization, and function
Domain deletion/truncation analysis:
Generate truncated versions removing putative functional domains
Create chimeric proteins with domains from related proteins
Assess impact on membrane integration and function
Site-directed mutagenesis of specific motifs:
Target predicted active sites or binding pockets
Modify potential iron-binding residues (His, Cys, Asp, Glu)
Alter charged residues that might participate in transport
Cysteine-scanning mutagenesis:
Introduce cysteine residues at strategic positions
Use thiol-specific labeling to probe accessibility
Apply crosslinking approaches to identify interaction partners
In vivo mutagenesis strategies:
CRISPR-Cas9 genome editing in Trichodesmium (if genetic tools available)
Complementation studies in knockout strains
Heterologous expression in model organisms
Mutant constructs should be systematically evaluated for:
Protein expression and stability
Membrane localization
Response to iron limitation
Interaction with known iron stress response components
Physiological effects (growth, N₂ fixation) when expressed in Trichodesmium
This comprehensive mutagenesis approach would systematically map structure-function relationships and potentially reveal Tery_3973's role in Trichodesmium physiology.
Integrated omics strategies offer powerful approaches to elucidate Tery_3973 function within the broader cellular context:
Transcriptomics:
Proteomics:
Quantitative proteomics to measure Tery_3973 abundance under different conditions
Protein-protein interaction studies (co-immunoprecipitation, proximity labeling)
Post-translational modification analysis
Membrane proteome characterization
Metabolomics:
Metabolic profiling during iron limitation
Stable isotope labeling to track metabolic fluxes
Correlation of metabolite changes with Tery_3973 expression
Structural omics:
Cryo-EM of purified Tery_3973 or membrane fragments
X-ray crystallography (challenging for membrane proteins)
NMR studies of specific domains
Molecular dynamics simulations based on structural predictions
Functional genomics:
CRISPR interference (CRISPRi) to modulate Tery_3973 expression
Transposon mutagenesis screens to identify genetic interactions
Synthetic biology approaches with modified Tery_3973 variants
Systems biology integration:
Multi-omics data integration
Network analysis to position Tery_3973 in cellular pathways
Predictive modeling of iron stress response
These approaches should be applied across iron-replete and iron-limited conditions, with appropriate temporal resolution to capture both rapid responses and long-term acclimation . The integration of multiple omics datasets would provide a comprehensive view of Tery_3973's role in cellular processes and its contribution to Trichodesmium's adaptation to varying iron availability.
Protein aggregation is a common challenge with membrane proteins like Tery_3973. A systematic troubleshooting approach includes:
Expression optimization:
Reduce expression rate by lowering induction temperature (16-20°C)
Decrease inducer concentration (0.1-0.2 mM IPTG)
Use specialized strains (C41/C43) designed for membrane proteins
Consider co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)
Solubilization strategies:
Screen multiple detergents systematically
Test detergent mixtures (e.g., DDM+CHS, LMNG+CHS)
Evaluate mild solubilization at extended times (overnight at 4°C)
Consider novel solubilization agents (SMALPs, nanodiscs, amphipols)
Buffer optimization:
Adjust pH away from protein pI (typically pH 7.5-8.5)
Modify salt concentration (150-500 mM NaCl)
Add stabilizing agents (glycerol 5-20%, arginine 50-200 mM)
Include reducing agents if the protein contains cysteines
Aggregation prevention during purification:
Maintain constant detergent concentration above CMC
Control temperature (4°C throughout purification)
Add lipids to stabilize native conformation
Consider on-column refolding approaches
Analytical methods to monitor aggregation:
Size exclusion chromatography
Dynamic light scattering
Analytical ultracentrifugation
Blue native PAGE
If aggregation persists, structural biology techniques such as hydrogen-deuterium exchange mass spectrometry can identify aggregation-prone regions, informing the design of stabilized constructs .
When facing contradictory results in Tery_3973 research, a methodical analysis approach is essential:
Systematic source analysis:
| Source of Contradiction | Investigation Approach | Resolution Strategy |
|---|---|---|
| Experimental conditions | Compare temperature, media, light, growth phase | Standardize conditions or identify condition-dependent effects |
| Protein preparation | Analyze detergent, buffer, purification method | Determine impact of preparation on protein conformation |
| Strain/species differences | Compare Tery_3973 sequences across strains used | Identify key sequence variations explaining functional differences |
| Methodological variations | Evaluate assay sensitivity, specificity, controls | Develop standardized protocols with appropriate controls |
| Data analysis approaches | Review statistical methods, normalization, outlier handling | Apply multiple analysis methods to test robustness |
Integrative validation approaches:
Deploy multiple orthogonal techniques to test the same hypothesis
Seek independent laboratory verification of key findings
Combine in vitro and in vivo approaches
Contextual interpretation:
Consider iron concentration dependence (results may differ at different iron levels)
Examine temporal factors (acute vs. chronic responses)
Assess developmental stage influences
Resolution framework:
Contradictions often reveal important nuances in protein function or experimental limitations, and their resolution frequently leads to deeper mechanistic understanding .
Researchers should be aware of several potential pitfalls when designing and interpreting Tery_3973 activity assays:
Protein preparation challenges:
Insufficient purity leading to contaminating activities
Loss of native conformation during purification
Detergent interference with activity assays
Incomplete reconstitution into membrane mimetics
Assay design issues:
Undefined or assumed function leading to inappropriate assay selection
Sub-optimal assay conditions (pH, temperature, ionic strength)
Inadequate controls for spontaneous reactions
Inappropriate enzyme:substrate ratios
Iron-specific considerations:
Trace iron contamination from buffers or labware
Oxidation state changes during experiment
Metal chelation by buffer components
Redox cycling creating reactive oxygen species
Technical considerations:
Detergent interference with colorimetric/fluorescent assays
Signal-to-noise ratio limitations
Time-dependent activity changes
Protein concentration determination errors in detergent solutions
Interpretation errors:
To address these challenges, researchers should implement appropriate controls, validate assays with proteins of known function, and triangulate results using multiple methodological approaches .
Rigorous antibody validation is essential for reliable Tery_3973 detection in research applications:
Initial validation experiments:
Specificity assessment:
Immunoprecipitation followed by mass spectrometry
Testing against closely related proteins
Evaluation in different sample types (whole cell, membrane fractions)
Assessment with overexpression systems
Technical validation:
Antibody titration to determine optimal concentration
Evaluation of different sample preparation methods
Testing multiple detection systems
Lot-to-lot consistency verification
Application-specific validation:
For Western blotting: Molecular weight verification, loading controls
For immunofluorescence: Co-localization with membrane markers
For flow cytometry: Comparison with isotype controls
For immunoprecipitation: Non-specific binding assessment
Documentation standards:
For Tery_3973, the transmembrane nature of the protein requires special consideration, including careful selection of immunogenic epitopes from accessible regions and appropriate membrane protein extraction protocols .
Investigating Tery_3973 in its native environment presents unique challenges but offers authentic functional insights:
Advanced microscopy techniques:
Super-resolution microscopy to visualize membrane localization
Correlative light and electron microscopy (CLEM)
Cryo-electron tomography of Trichodesmium cells
Live-cell imaging with minimally invasive tags
Genetic approaches:
Development of genetic systems for Trichodesmium
CRISPR-Cas9 genome editing for tagged endogenous expression
Inducible expression systems to modulate levels
Reporter fusions to monitor expression in situ
Environmental sampling strategies:
Analysis across natural iron gradients in oceans
Temporal sampling during bloom development
Single-cell approaches in natural populations
Mesocosm experiments with controlled iron manipulation
In situ protein analysis:
Proximity labeling in native cells
Crosslinking mass spectrometry
Thermal proteome profiling
Activity-based protein profiling
Multi-organism considerations:
Comparison across Trichodesmium species/strains
Co-culture experiments with associated microbiota
Examination of trophic interactions
These approaches can be integrated with oceanographic measurements to correlate Tery_3973 dynamics with environmental parameters, particularly iron availability, providing ecological context for molecular findings . This multi-scale investigation would link molecular mechanisms to ecosystem functions, advancing understanding of how Trichodesmium adapts to oligotrophic ocean environments .
Tery_3973's potential role in climate change adaptation merits investigation through several research avenues:
Ocean acidification interactions:
Examine Tery_3973 expression under varying pH conditions
Investigate potential role in maintaining membrane integrity during pH stress
Study combined effects of pH and iron limitation on expression and function
Temperature adaptation mechanisms:
Iron bioavailability changes:
Model impacts of changing ocean circulation on iron availability
Study Tery_3973 regulation under predicted future iron scenarios
Investigate adaptive evolution of the gene under selective pressure
Nitrogen fixation resilience:
Ecological modeling integration:
Incorporate molecular-level adaptations into ecosystem models
Predict biogeographical shifts based on Tery_3973-mediated adaptations
Develop early warning indicators for bloom resilience
This research would contribute to understanding how fundamental molecular mechanisms might allow Trichodesmium to adapt to changing ocean conditions, with implications for global nitrogen and carbon cycles in future climate scenarios .
Advanced structural biology approaches offer promising avenues for elucidating Tery_3973 function:
These structural studies would reveal molecular details of Tery_3973's membrane integration, potential binding sites, and conformational dynamics, providing mechanistic insights into its function in Trichodesmium's adaptation to iron limitation and other environmental stressors .
Incorporating molecular-level understanding of Tery_3973 into marine ecosystem models represents an emerging frontier in ecological prediction:
Multi-scale model integration:
Linking protein-level responses to cellular physiology
Scaling cellular adaptations to population dynamics
Incorporating population changes into biogeochemical models
Connecting biogeochemical cycles to climate models
Parameterization improvements:
Predictive applications:
Forecasting Trichodesmium bloom dynamics under climate change scenarios
Predicting nitrogen fixation rates in response to changing iron deposition
Mapping potential range shifts based on molecular adaptation capacity
Assessing ecosystem resilience informed by molecular mechanisms
Model validation approaches:
Field sampling to correlate Tery_3973 expression with model predictions
Mesocosm experiments testing model-predicted responses
Remote sensing validation of bloom prediction accuracy
Historical reconstruction testing using paleoceanographic data
Knowledge gaps requiring attention:
This research direction represents a transformative approach to ecological modeling, where fundamental molecular mechanisms inform predictions of ecosystem-level processes with global biogeochemical implications .