Recombinant Trichodesmium erythraeum UPF0754 membrane protein Tery_3973 (Tery_3973)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Trichodesmium erythraeum UPF0754 membrane protein Tery_3973, also known as Tery_3973, is a protein derived from the cyanobacterium Trichodesmium erythraeum . Trichodesmium erythraeum is a marine cyanobacterium known for its ability to fix nitrogen and its significant role in marine ecosystems . Tery_3973 is a UPF0754 membrane protein with unknown function .

Basic Information

FeatureDescription
Full NameRecombinant Full Length Trichodesmium erythraeum UPF0754 Membrane Protein Tery_3973(Tery_3973) Protein, His-Tagged
SourceTrichodesmium erythraeum
HostE. coli
TagHis-Tag
Protein LengthFull Length (1-408 amino acids)
UniProt IDQ10XM6
SynonymsTery_3973; UPF0754 membrane protein Tery_3973

Protein Properties

Tery_3973 is expressed in E. coli and tagged with N-terminal His for purification purposes . The protein's molecular weight is approximately 46.2 kDa . The protein is stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . It is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the option to add 5-50% glycerol for long-term storage at -20°C/-80°C .

The amino acid sequence of Tery_3973 is:
MSNIWLYFVPPIAGGIIGYFTNDIAIKMLFRPYRPYYIFRRKLPFTPGLIPANQERLAKRVADTIMGSLLTPSELQNLARRLLQTERMEAAILWLLQMSLDQLKLNTDTKSTKILANILRDLLGQSLPRLLKVWAKREYFLEAQINQIFDQILLEFQLTEIQAAQLSDWLLKVVVPPDVL
RKTLIDFLTDQNISIIDEGFREKASGTYWVVANLFGLRNTLTRLRTFCLDERDLTNQRLMELITALAVKERITEWLHSLSMQNLPVSTVRELRNTMQNSVRLYLQENGTDLIQALSLSVAWEHIADLIINRLQASSIMNSSLELVSRELALILERYLERDLENIVALAIPILNIDQVIID
RIKGT

Function and Role

The precise function of Tery_3973 is currently unknown, but it is annotated as a UPF0754 membrane protein . UPF0754 proteins are a family of proteins with largely uncharacterized functions . Membrane proteins are involved in various cellular processes, including transport, signaling, and maintaining cell structure . Further research is needed to elucidate the specific role of Tery_3973 in Trichodesmium erythraeum .

Expression and Regulation

Studies combining transcriptomics and proteomics have provided insights into the expression patterns of genes and proteins in Trichodesmium erythraeum under different environmental conditions, such as phosphorus deficiency . While the study does not directly mention Tery_3973, it highlights the importance of integrating transcriptome and proteome data to understand the physiological responses of Trichodesmium erythraeum .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tery_3973; UPF0754 membrane protein Tery_3973
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Trichodesmium erythraeum (strain IMS101)
Target Names
Tery_3973
Target Protein Sequence
MSNIWLYFVPPIAGGIIGYFTNDIAIKMLFRPYRPYYIFRRKLPFTPGLIPANQERLAKR VADTIMGSLLTPSELQNLARRLLQTERMEAAILWLLQMSLDQLKLNTDTKSTKILANILR DLLGQSLPRLLKVWAKREYFLEAQINQIFDQILLEFQLTEIQAAQLSDWLLKVVVPPDVL RKTLIDFLTDQNISIIDEGFREKASGTYWVVANLFGLRNTLTRLRTFCLDERDLTNQRLM ELITALAVKERITEWLHSLSMQNLPVSTVRELRNTMQNSVRLYLQENGTDLIQALSLSVA WEHIADLIINRLQASSIMNSSLELVSRELALILERYLERDLENIVALAIPILNIDQVIID RIKGTSAEELEVAVNVIVKNELQAIVNLGGVLGVVVGSFQTILLVLQR
Uniprot No.

Target Background

Database Links
Protein Families
UPF0754 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Trichodesmium erythraeum UPF0754 membrane protein Tery_3973?

Tery_3973 is a full-length membrane protein (408 amino acids) from the marine cyanobacterium Trichodesmium erythraeum. It belongs to the UPF0754 protein family, a group of uncharacterized membrane proteins. The protein has been successfully expressed as a recombinant protein with an N-terminal His tag in E. coli expression systems . Trichodesmium erythraeum plays critical roles in global carbon and nitrogen cycles, and understanding its membrane proteins is essential for elucidating how these organisms adapt to their marine environments .

The protein's membrane localization suggests it may be involved in transport or signaling functions, potentially relating to the organism's response to environmental stressors such as iron limitation. While the specific function remains to be fully characterized, its conservation across Trichodesmium species indicates evolutionary importance .

How is recombinant Tery_3973 typically expressed and purified?

Recombinant Tery_3973 is typically expressed in E. coli expression systems with an N-terminal His tag to facilitate purification. The methodological approach involves several key steps:

  • Vector construction: The gene encoding Tery_3973 is cloned into an expression vector with an N-terminal His tag.

  • Expression conditions: Transformation into an appropriate E. coli strain, followed by culture in media optimized for membrane protein expression.

  • Induction: Expression is typically induced with IPTG at optimal temperature and duration.

  • Cell harvest and lysis: Bacterial cells are harvested by centrifugation and disrupted by methods such as sonication or French press.

  • Membrane fraction isolation: Differential centrifugation to separate the membrane fraction.

  • Solubilization: Membrane proteins require detergents for solubilization; common choices include n-dodecyl β-D-maltoside (DDM) or Triton X-100.

  • Affinity purification: His-tagged protein is purified using Ni-NTA or similar affinity resins.

  • Quality control: SDS-PAGE and Western blotting to verify purity and identity .

For membrane proteins like Tery_3973, optimization of detergent conditions is crucial for maintaining protein stability and native conformation during purification.

What are the optimal storage conditions for recombinant Tery_3973?

Based on established protocols for similar membrane proteins, the optimal storage conditions for recombinant Tery_3973 include:

  • Buffer composition: Tris/PBS-based buffer at pH 8.0, containing 6% trehalose as a stabilizing agent .

  • Temperature: Store at -20°C to -80°C for long-term storage, with -80°C preferred for extended periods .

  • Aliquoting: Divide the purified protein into small single-use aliquots to avoid repeated freeze-thaw cycles, which can compromise protein integrity .

  • Glycerol addition: Addition of glycerol (typically 5-50% final concentration) helps prevent freeze damage and maintain protein stability during storage .

  • Reconstitution: When needed, reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

It is strongly recommended to avoid repeated freeze-thaw cycles, and working aliquots can be maintained at 4°C for up to one week to minimize degradation .

What is the role of Trichodesmium erythraeum in marine ecosystems?

Trichodesmium erythraeum plays fundamental roles in marine ecosystems, particularly in global biogeochemical cycles:

  • Nitrogen fixation: As a diazotrophic cyanobacterium, T. erythraeum converts atmospheric N₂ into biologically available nitrogen forms, significantly contributing to marine primary productivity in nutrient-limited waters .

  • Carbon cycling: Through photosynthesis and nitrogen fixation, it contributes substantially to carbon fixation in oligotrophic ocean regions .

  • Bloom formation: Forms extensive blooms ("sea sawdust") visible from space, affecting marine nutrient dynamics across large areas.

  • Climate interaction: The nitrogen and carbon cycling activities of Trichodesmium have implications for global climate models and carbon sequestration.

  • Ecological adaptations: T. erythraeum has evolved specialized mechanisms to thrive in nutrient-limited environments, including sophisticated responses to iron limitation, as iron is a critical cofactor for the nitrogenase enzyme complex .

Understanding Tery_3973 and similar proteins may provide insights into how these organisms adapt to their ecological niches, particularly in response to trace metal availability which constrains nitrogen fixation rates .

What expression systems yield optimal results for recombinant Tery_3973?

For optimal expression of recombinant Tery_3973, researchers should consider these methodological approaches:

  • Codon optimization: Adapting the gene sequence to E. coli codon usage, especially considering that cyanobacterial genes often contain rare codons.

  • Temperature modulation: Lower temperatures (16-20°C) during induction to slow protein production and improve folding.

  • Induction optimization: Testing various IPTG concentrations and induction durations.

  • Media supplementation: Addition of iron and other trace elements relevant to the protein's native environment .

When designing expression experiments, implementing a factorial design approach allows systematic identification of optimal conditions while minimizing experimental runs .

How can I optimize the solubility of Tery_3973 during expression and purification?

Optimizing solubility for membrane proteins like Tery_3973 requires careful consideration of multiple factors:

  • Fusion partners: Consider using solubility-enhancing fusion partners such as MBP (maltose-binding protein), SUMO, or Thioredoxin at the N-terminus.

  • Detergent screening: Systematic testing of different detergents is critical:

Detergent ClassExamplesRecommended ConcentrationBest For
Mild non-ionicDDM, DM, OG1-2× CMCInitial extraction
ZwitterionicLDAO, Fos-Choline2-5× CMCHigher stringency
Steroid-basedDigitonin, CHAPS0.5-1%Native complex preservation
Neopentyl glycolLMNG, UDM0.01-0.05%Long-term stability
  • Lipid supplementation: Addition of E. coli polar lipids (0.01-0.1 mg/mL) or specific phospholipids can stabilize membrane proteins.

  • Buffer optimization:

    • pH screening (typically 7.0-8.5)

    • Salt concentration (100-500 mM NaCl)

    • Glycerol addition (5-20%)

    • Stabilizing agents (trehalose, sucrose, arginine)

  • Extraction conditions: Gentle solubilization with moderate detergent concentrations over extended periods (e.g., 2-4 hours) at 4°C.

  • Purification design: Implement a multi-step purification strategy with carefully controlled detergent exchange during each step .

Given that Tery_3973 has been successfully prepared as a lyophilized powder, researchers should note that the reconstitution process is equally important, using deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL .

What controls should be included in functional assays for Tery_3973?

When designing functional assays for Tery_3973, comprehensive controls ensure experimental validity and interpretable results:

  • Positive controls:

    • Well-characterized membrane proteins from the same family

    • Proteins with known response to iron limitation

    • Other characterized UPF0754 family proteins (if available)

  • Negative controls:

    • Empty vector/expression system

    • Heat-denatured Tery_3973

    • Unrelated membrane protein expressed under identical conditions

  • Experimental validation controls:

    • Wild-type Trichodesmium erythraeum cells under normal and iron-limited conditions

    • Mutant strains (if available) with modified expression of Tery_3973

  • Technical controls:

    • Detergent-only controls to assess detergent effects on assay systems

    • Buffer composition controls

    • Protein concentration gradients to establish dose-response relationships

  • Specificity controls:

    • Site-directed mutants affecting key residues

    • Truncation variants to identify functional domains

    • Competitive inhibition assays if ligands are identified

For iron stress response studies specifically, parallel examination of known iron-responsive genes such as isiB, idiA, and feoB provides important contextual information . The experimental design should incorporate both biological and technical replicates with appropriate statistical power to detect physiologically relevant differences .

How should experiments be designed to study Tery_3973's response to iron stress?

Based on established approaches for studying iron stress responses in Trichodesmium, a comprehensive experimental design should include:

  • Growth conditions matrix:

Iron ConcentrationNitrogen SourceTemperatureLight IntensitySampling Points
Replete (>10 nM)N₂ onlyOptimal (25-28°C)50-100 μmol photons/m²/sEarly, mid, late exponential
Limited (1-5 nM)N₂ onlyOptimal (25-28°C)50-100 μmol photons/m²/sEarly, mid, late exponential
Depleted (<1 nM)N₂ onlyOptimal (25-28°C)50-100 μmol photons/m²/sEarly, mid, late exponential
Replete (>10 nM)NO₃⁻ (control)Optimal (25-28°C)50-100 μmol photons/m²/sEarly, mid, late exponential
  • Parallel measurements:

    • Tery_3973 expression levels (RT-qPCR, Western blot)

    • Known iron stress marker genes (isiB, idiA, feoB)

    • Physiological parameters (growth rate, chlorophyll content)

    • Nitrogen fixation rates (acetylene reduction assay)

    • Iron quotas (cellular iron content)

  • Temporal considerations:

    • Short-term responses (hours)

    • Acclimation phase (days)

    • Long-term adaptation (weeks)

  • Multiple Trichodesmium species/strains:

    • T. erythraeum (IMS101 and GBRTRLI101)

    • T. tenue (Z-1 and H9-4)

    • T. thiebautii

    • T. spiralis

  • Statistical design:

    • Minimum three biological replicates

    • Randomized block design to control for batch effects

    • Power analysis to determine sample size requirements

This systematic approach allows for identification of correlations between Tery_3973 expression patterns and physiological responses to iron stress, while controlling for confounding variables .

What statistical approaches are most appropriate for analyzing Tery_3973 experimental data?

Statistical analysis of Tery_3973 experimental data should be tailored to the experimental design and research questions:

  • For gene expression studies:

    • Normalization methods: Use multiple reference genes (minimum 3) tested for stability under experimental conditions

    • Differential expression: ANOVA with post-hoc tests (Tukey or Dunnett) for multiple comparisons

    • qPCR data: ΔΔCt method with efficiency correction

    • Correlation analysis: Pearson or Spearman correlation between Tery_3973 expression and physiological parameters

  • For protein function assays:

    • Enzyme kinetics: Non-linear regression for determination of kinetic parameters

    • Dose-response relationships: Four-parameter logistic regression

    • Time-course experiments: Repeated measures ANOVA or mixed-effects models

  • For multi-species/strain comparisons:

    • Phylogenetic comparative methods to account for evolutionary relationships

    • MANOVA for simultaneous analysis of multiple response variables

    • Principal Component Analysis (PCA) or Non-metric Multidimensional Scaling (NMDS) for pattern detection

  • For experimental design optimization:

    • Response surface methodology to optimize multiple parameters simultaneously

    • Factorial or fractional factorial designs to identify significant factors and interactions

  • For managing measurement uncertainty:

    • Propagation of error calculations for derived measurements

    • Bootstrap or jackknife resampling for robust confidence intervals

    • Bayesian approaches for complex models with prior information

Researchers should implement appropriate methods for handling missing data and outliers, and report effect sizes alongside p-values to indicate biological significance in addition to statistical significance .

How does Tery_3973 relate to the iron stress response in Trichodesmium?

While specific research on Tery_3973's role in iron stress response is limited, analysis should be contextualized within the broader iron stress response framework in Trichodesmium:

  • Genomic context: Trichodesmium erythraeum contains many archetypical genes involved in prokaryotic iron stress response. Three key genes—isiB, idiA, and feoB—show clear iron stress responses in axenic T. erythraeum (IMS101) .

  • Comparative expression: Analysis could examine whether Tery_3973 expression patterns correlate with these known iron-responsive genes. Quantitative PCR with gene-specific primers should be performed under varying iron concentrations.

  • Clade considerations: Iron stress responses appear conserved across both major Trichodesmium clades (T. erythraeum and T. tenue), suggesting evolutionary importance. The conservation patterns of Tery_3973 should be examined across these clades .

  • Physiological correlations: High expression of iron stress genes corresponds to specific reductions in N₂ fixation rates. Similar correlations could be investigated for Tery_3973 .

  • Membrane protein function: As a membrane protein, Tery_3973 may function in:

    • Iron transport or sensing

    • Signal transduction related to iron availability

    • Membrane reorganization under stress conditions

Advanced research would benefit from both transcriptomic and proteomic approaches to determine if Tery_3973 is co-regulated with known iron stress response elements, potentially revealing its role in this critical adaptive pathway .

How conserved is Tery_3973 across different Trichodesmium species?

The conservation of Tery_3973 across Trichodesmium species provides valuable insights into its evolutionary and functional importance:

Examining conservation patterns requires:

Based on the pattern observed with other iron stress response genes (isiB, idiA, and feoB) which are well conserved across Trichodesmium species, Tery_3973 may show similar conservation if it plays a role in this critical adaptive pathway . Significant conservation would support the hypothesis that this protein serves an important function in the ecological adaptation of Trichodesmium to oligotrophic ocean environments.

What structural features of Tery_3973 contribute to its membrane localization?

Understanding the structural features of Tery_3973 that facilitate membrane localization requires detailed analysis of its sequence and predicted structure:

  • Transmembrane domain prediction:
    Analysis of the 408-amino acid sequence using multiple topology prediction algorithms (TMHMM, HMMTOP, Phobius) likely reveals multiple transmembrane helices. The hydrophobicity profile and sequence characteristics suggest it is an integral membrane protein rather than a peripheral membrane-associated protein .

  • Key structural features:

    • N-terminal signal sequence or membrane targeting sequence

    • Hydrophobic transmembrane segments

    • Amphipathic helices at membrane interfaces

    • Charged residues defining topology (positive-inside rule)

    • Potential lipid interaction motifs

  • Post-translational modifications:

    • Prediction of potential lipidation sites (palmitoylation, myristoylation)

    • Phosphorylation sites that might regulate membrane association

  • Structural homology:
    While UPF0754 is an uncharacterized protein family, structural predictions using AlphaFold2 or similar tools may reveal structural similarities to characterized membrane proteins, providing functional insights.

  • Functional domains:
    Analysis may reveal signature domains associated with:

    • Transport functions

    • Signal transduction

    • Protein-protein interaction sites

    • Substrate binding regions

Experimental validation of these predictions would require techniques such as cysteine scanning mutagenesis, fluorescence microscopy of GFP fusion proteins, or protease protection assays to determine topology and membrane insertion mechanisms .

What mutagenesis approaches could help elucidate Tery_3973 function?

Systematic mutagenesis strategies can provide valuable insights into Tery_3973 function:

  • Alanine-scanning mutagenesis:

    • Systematically replace conserved or charged residues with alanine

    • Target potential functional domains identified through bioinformatics

    • Evaluate effects on protein expression, localization, and function

  • Domain deletion/truncation analysis:

    • Generate truncated versions removing putative functional domains

    • Create chimeric proteins with domains from related proteins

    • Assess impact on membrane integration and function

  • Site-directed mutagenesis of specific motifs:

    • Target predicted active sites or binding pockets

    • Modify potential iron-binding residues (His, Cys, Asp, Glu)

    • Alter charged residues that might participate in transport

  • Cysteine-scanning mutagenesis:

    • Introduce cysteine residues at strategic positions

    • Use thiol-specific labeling to probe accessibility

    • Apply crosslinking approaches to identify interaction partners

  • In vivo mutagenesis strategies:

    • CRISPR-Cas9 genome editing in Trichodesmium (if genetic tools available)

    • Complementation studies in knockout strains

    • Heterologous expression in model organisms

Mutant constructs should be systematically evaluated for:

  • Protein expression and stability

  • Membrane localization

  • Response to iron limitation

  • Interaction with known iron stress response components

  • Physiological effects (growth, N₂ fixation) when expressed in Trichodesmium

This comprehensive mutagenesis approach would systematically map structure-function relationships and potentially reveal Tery_3973's role in Trichodesmium physiology.

What omics approaches could reveal new insights about Tery_3973 function?

Integrated omics strategies offer powerful approaches to elucidate Tery_3973 function within the broader cellular context:

  • Transcriptomics:

    • RNA-Seq under varying iron concentrations and growth conditions

    • Co-expression network analysis to identify genes with similar expression patterns

    • Comparison across Trichodesmium species and strains

    • Temporal expression analysis during iron limitation response

  • Proteomics:

    • Quantitative proteomics to measure Tery_3973 abundance under different conditions

    • Protein-protein interaction studies (co-immunoprecipitation, proximity labeling)

    • Post-translational modification analysis

    • Membrane proteome characterization

  • Metabolomics:

    • Metabolic profiling during iron limitation

    • Stable isotope labeling to track metabolic fluxes

    • Correlation of metabolite changes with Tery_3973 expression

  • Structural omics:

    • Cryo-EM of purified Tery_3973 or membrane fragments

    • X-ray crystallography (challenging for membrane proteins)

    • NMR studies of specific domains

    • Molecular dynamics simulations based on structural predictions

  • Functional genomics:

    • CRISPR interference (CRISPRi) to modulate Tery_3973 expression

    • Transposon mutagenesis screens to identify genetic interactions

    • Synthetic biology approaches with modified Tery_3973 variants

  • Systems biology integration:

    • Multi-omics data integration

    • Network analysis to position Tery_3973 in cellular pathways

    • Predictive modeling of iron stress response

These approaches should be applied across iron-replete and iron-limited conditions, with appropriate temporal resolution to capture both rapid responses and long-term acclimation . The integration of multiple omics datasets would provide a comprehensive view of Tery_3973's role in cellular processes and its contribution to Trichodesmium's adaptation to varying iron availability.

How can I address protein aggregation issues with recombinant Tery_3973?

Protein aggregation is a common challenge with membrane proteins like Tery_3973. A systematic troubleshooting approach includes:

  • Expression optimization:

    • Reduce expression rate by lowering induction temperature (16-20°C)

    • Decrease inducer concentration (0.1-0.2 mM IPTG)

    • Use specialized strains (C41/C43) designed for membrane proteins

    • Consider co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Solubilization strategies:

    • Screen multiple detergents systematically

    • Test detergent mixtures (e.g., DDM+CHS, LMNG+CHS)

    • Evaluate mild solubilization at extended times (overnight at 4°C)

    • Consider novel solubilization agents (SMALPs, nanodiscs, amphipols)

  • Buffer optimization:

    • Adjust pH away from protein pI (typically pH 7.5-8.5)

    • Modify salt concentration (150-500 mM NaCl)

    • Add stabilizing agents (glycerol 5-20%, arginine 50-200 mM)

    • Include reducing agents if the protein contains cysteines

  • Aggregation prevention during purification:

    • Maintain constant detergent concentration above CMC

    • Control temperature (4°C throughout purification)

    • Add lipids to stabilize native conformation

    • Consider on-column refolding approaches

  • Analytical methods to monitor aggregation:

    • Size exclusion chromatography

    • Dynamic light scattering

    • Analytical ultracentrifugation

    • Blue native PAGE

If aggregation persists, structural biology techniques such as hydrogen-deuterium exchange mass spectrometry can identify aggregation-prone regions, informing the design of stabilized constructs .

How should contradictory results in Tery_3973 studies be interpreted?

When facing contradictory results in Tery_3973 research, a methodical analysis approach is essential:

  • Systematic source analysis:

Source of ContradictionInvestigation ApproachResolution Strategy
Experimental conditionsCompare temperature, media, light, growth phaseStandardize conditions or identify condition-dependent effects
Protein preparationAnalyze detergent, buffer, purification methodDetermine impact of preparation on protein conformation
Strain/species differencesCompare Tery_3973 sequences across strains usedIdentify key sequence variations explaining functional differences
Methodological variationsEvaluate assay sensitivity, specificity, controlsDevelop standardized protocols with appropriate controls
Data analysis approachesReview statistical methods, normalization, outlier handlingApply multiple analysis methods to test robustness
  • Integrative validation approaches:

    • Deploy multiple orthogonal techniques to test the same hypothesis

    • Seek independent laboratory verification of key findings

    • Combine in vitro and in vivo approaches

  • Contextual interpretation:

    • Consider iron concentration dependence (results may differ at different iron levels)

    • Examine temporal factors (acute vs. chronic responses)

    • Assess developmental stage influences

  • Resolution framework:

    • Develop unified models accommodating seemingly contradictory results

    • Identify boundary conditions where different outcomes occur

    • Design critical experiments specifically addressing contradictions

Contradictions often reveal important nuances in protein function or experimental limitations, and their resolution frequently leads to deeper mechanistic understanding .

What are common pitfalls in Tery_3973 activity assays?

Researchers should be aware of several potential pitfalls when designing and interpreting Tery_3973 activity assays:

  • Protein preparation challenges:

    • Insufficient purity leading to contaminating activities

    • Loss of native conformation during purification

    • Detergent interference with activity assays

    • Incomplete reconstitution into membrane mimetics

  • Assay design issues:

    • Undefined or assumed function leading to inappropriate assay selection

    • Sub-optimal assay conditions (pH, temperature, ionic strength)

    • Inadequate controls for spontaneous reactions

    • Inappropriate enzyme:substrate ratios

  • Iron-specific considerations:

    • Trace iron contamination from buffers or labware

    • Oxidation state changes during experiment

    • Metal chelation by buffer components

    • Redox cycling creating reactive oxygen species

  • Technical considerations:

    • Detergent interference with colorimetric/fluorescent assays

    • Signal-to-noise ratio limitations

    • Time-dependent activity changes

    • Protein concentration determination errors in detergent solutions

  • Interpretation errors:

    • Confusing correlation with causation

    • Overinterpreting in vitro results without cellular context

    • Failure to account for cooperative effects with other proteins

    • Overlooking post-translational modifications

To address these challenges, researchers should implement appropriate controls, validate assays with proteins of known function, and triangulate results using multiple methodological approaches .

How can I validate antibodies for Tery_3973 detection?

Rigorous antibody validation is essential for reliable Tery_3973 detection in research applications:

  • Initial validation experiments:

    • Western blot against purified recombinant Tery_3973

    • Comparison of signal between wild-type and knockout/knockdown cells (if available)

    • Peptide competition assays to confirm specificity

    • Testing across multiple Trichodesmium species to assess cross-reactivity

  • Specificity assessment:

    • Immunoprecipitation followed by mass spectrometry

    • Testing against closely related proteins

    • Evaluation in different sample types (whole cell, membrane fractions)

    • Assessment with overexpression systems

  • Technical validation:

    • Antibody titration to determine optimal concentration

    • Evaluation of different sample preparation methods

    • Testing multiple detection systems

    • Lot-to-lot consistency verification

  • Application-specific validation:

    • For Western blotting: Molecular weight verification, loading controls

    • For immunofluorescence: Co-localization with membrane markers

    • For flow cytometry: Comparison with isotype controls

    • For immunoprecipitation: Non-specific binding assessment

  • Documentation standards:

    • Record antibody source, catalog number, lot, dilution

    • Document validation experiments with controls

    • Maintain consistent protocols for reproducibility

    • Consider antibody registration in validation repositories

For Tery_3973, the transmembrane nature of the protein requires special consideration, including careful selection of immunogenic epitopes from accessible regions and appropriate membrane protein extraction protocols .

What are promising approaches for studying Tery_3973 in its native environment?

Investigating Tery_3973 in its native environment presents unique challenges but offers authentic functional insights:

  • Advanced microscopy techniques:

    • Super-resolution microscopy to visualize membrane localization

    • Correlative light and electron microscopy (CLEM)

    • Cryo-electron tomography of Trichodesmium cells

    • Live-cell imaging with minimally invasive tags

  • Genetic approaches:

    • Development of genetic systems for Trichodesmium

    • CRISPR-Cas9 genome editing for tagged endogenous expression

    • Inducible expression systems to modulate levels

    • Reporter fusions to monitor expression in situ

  • Environmental sampling strategies:

    • Analysis across natural iron gradients in oceans

    • Temporal sampling during bloom development

    • Single-cell approaches in natural populations

    • Mesocosm experiments with controlled iron manipulation

  • In situ protein analysis:

    • Proximity labeling in native cells

    • Crosslinking mass spectrometry

    • Thermal proteome profiling

    • Activity-based protein profiling

  • Multi-organism considerations:

    • Comparison across Trichodesmium species/strains

    • Co-culture experiments with associated microbiota

    • Examination of trophic interactions

These approaches can be integrated with oceanographic measurements to correlate Tery_3973 dynamics with environmental parameters, particularly iron availability, providing ecological context for molecular findings . This multi-scale investigation would link molecular mechanisms to ecosystem functions, advancing understanding of how Trichodesmium adapts to oligotrophic ocean environments .

How might Tery_3973 contribute to climate change adaptation in marine cyanobacteria?

Tery_3973's potential role in climate change adaptation merits investigation through several research avenues:

  • Ocean acidification interactions:

    • Examine Tery_3973 expression under varying pH conditions

    • Investigate potential role in maintaining membrane integrity during pH stress

    • Study combined effects of pH and iron limitation on expression and function

  • Temperature adaptation mechanisms:

    • Compare Tery_3973 sequence and expression across Trichodesmium clades with different temperature optima

    • Investigate thermostability of the protein and temperature effects on function

    • Assess role in membrane fluidity regulation under thermal stress

  • Iron bioavailability changes:

    • Model impacts of changing ocean circulation on iron availability

    • Study Tery_3973 regulation under predicted future iron scenarios

    • Investigate adaptive evolution of the gene under selective pressure

  • Nitrogen fixation resilience:

    • Determine if Tery_3973 contributes to maintaining N₂ fixation under stress conditions

    • Examine correlation between Tery_3973 expression and nitrogenase protection mechanisms

    • Assess potential role in energy allocation during resource limitation

  • Ecological modeling integration:

    • Incorporate molecular-level adaptations into ecosystem models

    • Predict biogeographical shifts based on Tery_3973-mediated adaptations

    • Develop early warning indicators for bloom resilience

This research would contribute to understanding how fundamental molecular mechanisms might allow Trichodesmium to adapt to changing ocean conditions, with implications for global nitrogen and carbon cycles in future climate scenarios .

How might structural biology techniques advance understanding of Tery_3973?

Advanced structural biology approaches offer promising avenues for elucidating Tery_3973 function:

These structural studies would reveal molecular details of Tery_3973's membrane integration, potential binding sites, and conformational dynamics, providing mechanistic insights into its function in Trichodesmium's adaptation to iron limitation and other environmental stressors .

What are the implications of Tery_3973 research for marine ecosystem modeling?

Incorporating molecular-level understanding of Tery_3973 into marine ecosystem models represents an emerging frontier in ecological prediction:

  • Multi-scale model integration:

    • Linking protein-level responses to cellular physiology

    • Scaling cellular adaptations to population dynamics

    • Incorporating population changes into biogeochemical models

    • Connecting biogeochemical cycles to climate models

  • Parameterization improvements:

    • Developing mechanistic rather than empirical representations of iron limitation

    • Creating temperature dependence functions informed by molecular adaptations

    • Refining nitrogen fixation predictions based on molecular constraints

    • Establishing species-specific parameters based on Tery_3973 variants

  • Predictive applications:

    • Forecasting Trichodesmium bloom dynamics under climate change scenarios

    • Predicting nitrogen fixation rates in response to changing iron deposition

    • Mapping potential range shifts based on molecular adaptation capacity

    • Assessing ecosystem resilience informed by molecular mechanisms

  • Model validation approaches:

    • Field sampling to correlate Tery_3973 expression with model predictions

    • Mesocosm experiments testing model-predicted responses

    • Remote sensing validation of bloom prediction accuracy

    • Historical reconstruction testing using paleoceanographic data

  • Knowledge gaps requiring attention:

    • Quantitative relationships between Tery_3973 and physiological rates

    • Temporal dynamics of adaptation and acclimation

    • Interaction effects with other environmental stressors

    • Evolutionary constraints on adaptive capacity

This research direction represents a transformative approach to ecological modeling, where fundamental molecular mechanisms inform predictions of ecosystem-level processes with global biogeochemical implications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.