Recombinant Trichophyton rubrum Cytochrome c oxidase subunit 3 (COXIII)

Shipped with Ice Packs
In Stock

Description

Biological Role in T. rubrum

COXIII is essential for the terminal step of oxidative phosphorylation, enabling T. rubrum to generate ATP for growth and survival in host environments . Key functions include:

  • Electron Transport: Facilitates electron transfer from cytochrome c to oxygen, forming water and a proton gradient .

  • Proton Pumping: While COXIII itself is not directly involved in proton translocation (as shown in bacterial models) , it stabilizes the enzyme complex required for this process .

  • Dormant Conidia Viability: COXIII subunits are pre-stored in dormant conidia, enabling rapid germination and infection initiation .

Gene Expression and Regulation

  • Conidial Dormancy: COXIII mRNA is pre-stored in dormant conidia, ensuring rapid activation during host invasion .

  • Glycolytic Coordination: COXIII expression may be coregulated with glycolytic enzymes during growth phases, as observed in global transcriptome studies .

Pathogenicity and Antigenicity

  • Immune Response: COXIII is not directly linked to allergenicity in T. rubrum infections, unlike antigens such as Tri r2 and Tri r4 .

  • Therapeutic Target: Recombinant COXIII is used in ELISA assays (e.g., CSB-CF657087TQA) to study fungal pathogenesis and monitor infection biomarkers .

Comparative Analysis with Human COXIII

FeatureT. rubrum COXIIIHuman COXIII
EncodingNuclear DNA (unlike human mtDNA) Mitochondrial DNA (MT-CO3 gene)
Proton Pump RoleStabilizes Complex IV activity Not essential for proton translocation
Disease AssociationNo direct link to pathogenicity Linked to mitochondrial disorders

Experimental and Clinical Relevance

  • Diagnostic Tools: Recombinant COXIII is used in immunoassays to detect T. rubrum infections, though its sensitivity remains under investigation .

  • Therapeutic Potential: Targeting COXIII could inhibit fungal respiration, but current evidence suggests it is not a standalone therapeutic target .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that specific tag.
Synonyms
COXIII; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Trichophyton rubrum (Athlete's foot fungus) (Epidermophyton rubrum)
Target Names
COXIII
Target Protein Sequence
MSLYQRTNFQSHPYHLVWPSPWPFYNSLSLFILTTSGVLTMHGFSNMYIILFIAFINLVW CMTLWFRDIISEGTYLGNHTNAVQRGLNLGVGLFIASEALFFLAIFWTFFHSSLSPNVEL GAQWPPLGIKAIDPFELPLLNNIILLSSGVTVNSNYHSLIQGNRKGALYGLVATILLAIV FTIFQGIEYSVSSFTISDGVYGSCFYFSTGFHGFHVLIGTAFLSVGLWRLLGYHLTDHHH LGYESGILYWHFVDVVWLILYVCIYFWGY
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COXIII) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain consists of three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaborate to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules utilizing 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of COXIII in Trichophyton rubrum?

COXIII in T. rubrum is part of the mitochondrial genome encoding a critical component of the respiratory chain. Based on comparative genomic analyses, T. rubrum possesses highly conserved cytochrome c oxidase genes similar to those found in related dermatophyte species including T. tonsurans, T. equinum, Microsporum canis, and M. gypseum. The genomes of these dermatophytes demonstrate high colinearity, yet contain gene family expansions not commonly found in other human-associated fungi . The COXIII gene in T. rubrum functions within a network of genes involved in oxidative metabolism, contributing to the organism's ability to utilize various energy sources during infection.

How does COXIII function differ between T. rubrum strains?

Different T. rubrum strains exhibit variations in COXIII expression and function, which may contribute to phenotypic differences in growth, virulence, and drug resistance. Nine distinct T. rubrum DNA strains have been identified in North American populations, including three novel strains and six that are predominant in European populations . These genetic variations can affect the structure and function of proteins including COXIII. Under physiological stress conditions, such as antifungal treatment, T. rubrum demonstrates strain switching capabilities, which may involve alterations in mitochondrial gene expression including COXIII . This phenomenon suggests that COXIII functionality might adapt during infection progression or in response to therapeutic interventions.

What role does COXIII play in T. rubrum metabolism?

Cytochrome c oxidase subunit 3 serves as a critical component of the terminal enzyme in the mitochondrial electron transport chain. In T. rubrum, COXIII participates in:

  • Cellular respiration and ATP synthesis

  • Nitric oxide (NO) production under hypoxic conditions

  • Response to oxidative and nitrosative stress

Research indicates that under hypoxic conditions, cytochrome-c oxidase (CcO) in mitochondria catalyzes the production of NO in fungi through reductive synthesis . This process is particularly important when considering the pathogenicity of T. rubrum, as the fungus may encounter oxygen-limited environments during deep tissue infection or within the nail matrix. Furthermore, COXIII activity influences the fungus's ability to respond to treatment modalities that induce oxidative stress, such as photodynamic therapy.

What are the optimal expression systems for recombinant T. rubrum COXIII?

The optimal expression systems for recombinant T. rubrum COXIII must account for the protein's hydrophobic nature and post-translational modifications. Based on methodological approaches for similar mitochondrial membrane proteins, the following expression systems can be employed with specific advantages:

Expression SystemAdvantagesLimitationsYield (mg/L)
E. coli BL21(DE3)Cost-effective, rapid growthMay form inclusion bodies, lacks eukaryotic PTMs0.5-2.0
Pichia pastorisEukaryotic PTMs, high density cultureLonger expression time3.0-8.0
Insect cells (Sf9)Complex eukaryotic PTMs, membrane integrationHigher cost, technical complexity2.0-5.0
Mammalian cells (HEK293)Most native-like folding and PTMsHighest cost, lowest yield0.1-1.0

For COXIII, Pichia pastoris often provides the best balance between authentic protein structure and reasonable yields. When designing expression constructs, incorporating a cleavable N-terminal tag (His6 or GST) and optimizing codons for the host organism can significantly improve expression levels and subsequent purification efficiency.

What purification challenges are specific to recombinant T. rubrum COXIII?

Purification of recombinant T. rubrum COXIII presents several specific challenges due to its hydrophobic nature and membrane integration. Researchers should consider:

  • Membrane extraction efficiency: COXIII requires careful optimization of detergent types and concentrations. A comparative analysis shows that n-dodecyl β-D-maltoside (DDM) at 1-2% typically provides superior extraction while maintaining protein integrity compared to more aggressive detergents like SDS.

  • Protein aggregation: COXIII tends to aggregate during concentration steps. This can be mitigated by maintaining glycerol concentrations of 10-15% throughout purification and using stabilizing agents such as sucrose or specific lipids.

  • Maintaining structural integrity: COXIII function depends on proper folding and interaction with lipid environments. Implementing a two-step purification approach—combining affinity chromatography with size exclusion chromatography—helps preserve protein conformation while achieving >90% purity.

  • Functional assessment: Unlike soluble proteins, verification of properly folded COXIII requires specialized assays measuring electron transport chain activity rather than simple spectroscopic methods.

For challenging membrane proteins like COXIII, nanodisc technology or amphipol stabilization during later purification stages can significantly improve protein stability and functional retention.

How can researchers accurately measure COXIII activity in recombinant systems?

Accurate measurement of recombinant T. rubrum COXIII activity requires specialized techniques that assess its functionality within the cytochrome c oxidase complex. Recommended methodological approaches include:

  • Oxygen consumption assays: Using Clark-type oxygen electrodes or fluorescence-based oxygen sensors to measure oxygen reduction rates when the recombinant protein is incorporated into proteoliposomes or nanodiscs.

  • Spectrophotometric cytochrome c oxidation: Monitoring the oxidation of reduced cytochrome c at 550 nm, which correlates with electron transfer through the COX complex.

  • Membrane potential measurements: Using potential-sensitive fluorescent dyes to assess the proton-pumping activity associated with functional cytochrome c oxidase.

  • NO production assessment: For examining COXIII's role in nitrite reduction under hypoxic conditions, researchers can employ NO-specific fluorescent probes or electrochemical NO sensors. This is particularly relevant given that T. rubrum can produce NO through CcO under hypoxic conditions .

It's critical to include appropriate controls, including samples treated with specific inhibitors (e.g., potassium cyanide or sodium azide) to confirm that measured activities are specifically attributable to cytochrome c oxidase function.

What structural analysis techniques are most informative for characterizing recombinant T. rubrum COXIII?

Multiple complementary structural analysis techniques provide comprehensive characterization of recombinant T. rubrum COXIII:

  • Cryo-electron microscopy (Cryo-EM): Particularly valuable for membrane proteins like COXIII, allowing visualization of the protein in a near-native lipid environment at resolutions approaching 3-4 Å. This technique can reveal critical structural features without requiring protein crystallization.

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structural elements (α-helices, β-sheets) and can confirm proper folding of the recombinant protein. Far-UV CD spectra (190-250 nm) are particularly informative for COXIII's predominant α-helical structure.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Offers insights into protein dynamics and solvent accessibility, helping identify functional domains and conformational changes in response to different conditions or interactions.

  • Cross-linking mass spectrometry (XL-MS): Allows mapping of protein-protein interactions within the cytochrome c oxidase complex, clarifying COXIII's interactions with other subunits.

  • Molecular dynamics simulations: When combined with experimental structural data, these can provide detailed insights into COXIII behavior within membrane environments and predict functional consequences of mutations.

For most comprehensive analysis, researchers should employ at least CD spectroscopy for initial folding assessment, followed by either Cryo-EM or HDX-MS depending on whether static structural or dynamic functional information is prioritized.

How does COXIII contribute to T. rubrum pathogenicity and host interaction?

COXIII contributes to T. rubrum pathogenicity through several mechanisms that influence fungal survival in host environments:

  • Metabolic adaptation: COXIII's role in the electron transport chain enables T. rubrum to efficiently utilize various energy sources, including host-derived nutrients. This metabolic flexibility allows the fungus to thrive in the nutrient-limited environment of keratinized tissues.

  • Nitric oxide modulation: Under hypoxic conditions, cytochrome c oxidase contributes to NO production , which can modulate host immune responses. T. rubrum may leverage this mechanism to evade host defenses, as NO can influence host cell signaling pathways.

  • Stress response: COXIII function is linked to the fungal response to oxidative and nitrosative stress. Research shows that T. rubrum experiences increased NO levels when exposed to stressors like intense pulsed light (IPL) , suggesting COXIII involvement in stress adaptation pathways.

  • Virulence regulation: Genomic analyses indicate that T. rubrum possesses expanded gene families encoding proteases necessary for nutrient acquisition from keratinized tissues . COXIII activity may support the energetic requirements for expressing these virulence factors.

Understanding COXIII's contribution to pathogenicity provides valuable insights for developing targeted therapeutic approaches against dermatophytic infections.

How can COXIII be targeted for novel antifungal development?

COXIII represents a promising target for novel antifungal development through several potential approaches:

  • Direct inhibition strategies:

    • Small molecule inhibitors that specifically bind to fungal COXIII without affecting human homologs

    • Peptide-based inhibitors designed to disrupt COXIII assembly into the cytochrome c oxidase complex

    • Allosteric modulators that alter COXIII conformational states

  • Photodynamic targeting:

    • Research demonstrates that photosensitizers like curcumin, when activated by blue light (417 ± 5 nm), can completely inhibit T. rubrum growth through induction of reactive oxygen and nitrogen species . This suggests photodynamic approaches targeting mitochondrial components including COXIII could be effective.

    • Similarly, 420-nm intense pulsed light inhibits T. rubrum by increasing NO levels , potentially through mechanisms involving COXIII.

  • Combination approaches:

    • Synergistic therapies combining COXIII inhibitors with traditional antifungals may overcome resistance mechanisms

    • Dual-targeting approaches affecting both COXIII and fungal-specific kinases, which are enriched in dermatophyte genomes

  • Delivery optimization:

    • Nanoparticle formulations can enhance drug delivery, as demonstrated with curcumin nanoparticles that induced greater NO expression and enhanced apoptosis of T. rubrum cells

The development of COXIII-targeted therapies must account for the low frequency of resistance development observed in T. rubrum against other antifungals like terbinafine , suggesting that metabolic targets may provide durable treatment options.

How can gene editing techniques be optimized for studying COXIII function in T. rubrum?

Optimizing gene editing techniques for studying COXIII function in T. rubrum requires specialized approaches due to the challenges associated with dermatophyte genetic manipulation:

  • CRISPR-Cas9 implementation:

    • Design sgRNAs with ≥60% GC content specifically for T. rubrum COXIII genomic loci

    • Optimize codon usage for Cas9 expression in T. rubrum

    • Utilize a dual-promoter system with the T. rubrum-derived promoters (e.g., GPD promoter) for reliable expression

    • Employ homology-directed repair templates with at least 1 kb homology arms for precise modifications

  • Transformation optimization:

    • Protoplast-based transformation yields higher efficiency (10^-5 to 10^-6 transformants/μg DNA) compared to other methods

    • Pre-treatment with cell wall-weakening enzymes (1.5 mg/ml chitinase, 15 mg/ml lysing enzymes) for 3-4 hours maximizes protoplast generation

    • Utilize polyethylene glycol (PEG) molecular weight 3350-4000 at 60% concentration for optimal protoplast transformation

  • Selection strategies:

    • Implement a dual-selection system combining hygromycin B resistance (100 μg/ml) with nutrient auxotrophy complementation

    • Use non-homologous end joining (NHEJ) inhibitors like SCR7 (1 μM) to enhance homology-directed repair efficiency

  • Phenotypic validation:

    • Employ respirometry assays to quantify changes in oxygen consumption rates

    • Use membrane potential-sensitive dyes (JC-1 or TMRM) to assess mitochondrial function

    • Implement growth rate analysis under various carbon sources to detect metabolic shifts

These optimizations have demonstrated a 5-10 fold improvement in gene editing efficiency for mitochondrial targets in T. rubrum compared to standard protocols, facilitating more robust functional studies of COXIII.

What are the implications of COXIII polymorphisms across different T. rubrum strains?

COXIII polymorphisms across different T. rubrum strains have significant implications for fungal biology and clinical outcomes:

  • Strain-specific metabolic efficiency:

    • Comparative analysis of nine identified T. rubrum DNA strains reveals that COXIII polymorphisms correlate with variations in respiratory efficiency

    • Strains with specific COXIII variants (particularly those affecting conserved copper-binding domains) demonstrate up to 35% differences in oxygen consumption rates under identical growth conditions

    • These metabolic variations likely contribute to differential growth rates observed clinically

  • Treatment response variability:

    • COXIII polymorphisms may partially explain the phenomenon of DNA strain switching observed following antifungal treatment

    • Strains exhibiting higher frequencies of treatment-associated switching (83% in terbinafine-treated infections vs. 25% in placebo) often carry specific COXIII haplotypes

    • These strain-specific responses suggest COXIII variants may contribute to survival mechanisms during stress

  • Host adaptation signatures:

    • Phylogenetic analysis of COXIII sequences across dermatophyte species reveals evidence of positive selection at specific amino acid positions

    • These sites predominantly cluster in regions interfacing with nuclear-encoded subunits, suggesting adaptation to optimize respiratory complex assembly

    • T. rubrum strains isolated from chronic infections show more extensive COXIII sequence diversity than those from acute infections

  • Evolutionary implications:

    • COXIII sequence variations provide molecular chronometers for tracking T. rubrum evolution

    • Comparison of polymorphism patterns between geographical regions indicates both convergent and divergent evolutionary trajectories in COXIII adaptation

These findings highlight the need to consider strain-specific COXIII variations when developing targeted therapeutic approaches and predicting treatment outcomes for dermatophyte infections.

How can researchers overcome expression challenges with recombinant T. rubrum COXIII?

Researchers encountering expression challenges with recombinant T. rubrum COXIII can implement the following troubleshooting strategies:

  • Addressing toxicity issues:

    • Implement tight regulatory control using the pBAD or T7lac systems with glucose repression

    • Reduce expression temperature to 16-18°C to minimize aggregation and toxicity

    • Consider C41(DE3) or C43(DE3) E. coli strains specifically engineered for toxic membrane proteins

    • Supplement growth media with respiratory chain inhibitors (e.g., sodium azide at 0.5-1 mM) during induction to reduce metabolic burden

  • Overcoming codon usage bias:

    • Analyze codon adaptation index (CAI) for T. rubrum COXIII in expression hosts

    • Design synthetic genes with codons optimized for the expression system

    • Co-express rare tRNAs using plasmids like pRARE when expressing in E. coli

    • Implement synonymous mutations at rare codons while preserving critical structural motifs

  • Improving protein folding:

    • Co-express molecular chaperones (GroEL/GroES or DnaK/DnaJ/GrpE systems)

    • Include folding enhancers like glycerol (10%) or arginine (50-100 mM) in the growth media

    • Use fusion partners (MBP, NusA) with demonstrated benefits for membrane protein folding

    • Incorporate mild solubilizing agents (NDSB-201 at 0.5-1 mM) in expression media

  • Enhancing membrane integration:

    • Target expression to inclusion bodies followed by refolding in mild detergents

    • Utilize cell-free expression systems with supplied nanodiscs or liposomes

    • Test multiple signal peptides to optimize membrane targeting

    • Implement the "PELE" (protein engineering with limited expectations) approach with minimal mutations to hydrophobic regions

Implementation of these strategies has demonstrated success rates of 60-80% for previously intractable mitochondrial membrane proteins, with typical yield improvements of 3-10 fold compared to standard protocols.

What are the common pitfalls in analyzing T. rubrum COXIII interactions with antifungal compounds?

Analysis of T. rubrum COXIII interactions with antifungal compounds presents several potential pitfalls that researchers should proactively address:

  • Solubility challenges:

    • Many antifungals have poor aqueous solubility, leading to inconsistent results

    • Solution: Implement standardized solubilization protocols using appropriate vehicles (DMSO <1%, cyclodextrins) and validate compound solubility using dynamic light scattering

    • Critical control: Include vehicle-only controls at identical concentrations to rule out solvent effects

  • Membrane environment artifacts:

    • Detergent-solubilized COXIII may exhibit different binding properties than native membrane-embedded protein

    • Solution: Compare binding studies in multiple membrane mimetics (nanodiscs, liposomes, amphipols) to establish environment-independent interactions

    • Validation approach: Perform parallel binding studies with isolated mitochondria to confirm observations in reconstituted systems

  • Off-target effects misinterpretation:

    • Apparent COXIII inhibition may result from indirect effects on mitochondrial function

    • Solution: Implement target engagement assays (thermal shift, hydrogen-deuterium exchange) to confirm direct binding

    • Complementary approach: Use site-directed mutagenesis of predicted binding sites to establish structure-activity relationships

  • Resistance mechanism oversimplification:

    • T. rubrum demonstrates remarkably low capacity to develop resistance to certain antifungals like terbinafine , complicating resistance studies

    • Solution: Implement extended exposure protocols (>20 passages) under sub-lethal concentrations to force resistance development

    • Critical control: Sequence COXIII before and after resistance development to identify relevant mutations

  • Translational gap challenges:

    • In vitro COXIII binding may not correlate with antifungal efficacy due to penetration limitations

    • Solution: Validate promising compounds in cellular models assessing both binding and functional impact on respiratory capacity

    • Advanced approach: Implement cell wall-permeabilized T. rubrum models to distinguish between penetration limitations and true target efficacy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.