Recombinant Trichophyton rubrum NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Description

Role in Mitochondrial Respiration

ND6 is essential for Complex I assembly and function. A frameshift mutation in the ND6 gene of mice caused a near-complete loss of Complex I activity, reducing malate/glutamate-dependent respiration by ~90% and NADH:Q1 oxidoreductase activity by ~99% . Similar findings in T. rubrum suggest its ND6 subunit is indispensable for oxidative phosphorylation.

Biochemical Importance in Trichophyton rubrum

  • Energy Metabolism: Part of a complete aerobic respiratory chain in T. rubrum, enabling pyruvate degradation and ATP synthesis .

  • Pathogenicity: While not directly linked to virulence, its role in energy production supports fungal growth in host environments .

Research Applications

  • Structural Studies: His-tag facilitates purification for X-ray crystallography or cryo-EM .

  • Functional Assays: Testing inhibitors of Complex I or studying mitochondrial electron transport .

Handling Recommendations

  • Avoid Freeze-Thaw Cycles: Repeated exposure reduces activity .

  • Add Glycerol for Stability: 50% glycerol preserves conformation during long-term storage .

Comparative Analysis with Human ND6

While T. rubrum ND6 shares core functional roles with human ND6, key differences exist:

FeatureTrichophyton rubrum ND6Human ND6 (MT-ND6)
Gene LocationNuclear genome Mitochondrial DNA
Expression SystemHeterologous (E. coli) Native mitochondrial synthesis
TaggingHis tag for purification No tag (endogenous)
Pathogenic RelevanceLimited (metabolic support) Associated with mitochondrial disorders

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND6; NADH6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Trichophyton rubrum (Athlete's foot fungus) (Epidermophyton rubrum)
Target Names
ND6
Target Protein Sequence
MQLDLYVDKINNGFNSNILDILAFISIILGIYTIVSKNPVVSVLFLIGLFSTISIYLIMI GLTFIGLSYLLVYIGAVSILFLFILMLINIRISELVSTNNNYIPLAILSMITLVYILGQK IITNVVQFNILNSFTSSLFEKSFKESINYSNSLSWDTNLIDITHTSAIGNIMYSSYSFWL IIISLILLLAMVGSIVISIGRVI
Uniprot No.

Target Background

Function

Function: Recombinant Trichophyton rubrum NADH-ubiquinone oxidoreductase chain 6 (ND6) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Trichophyton rubrum and why is it significant in molecular biology research?

Trichophyton rubrum is a dermatophytic fungus in the phylum Ascomycota. It exists as an exclusively clonal, anthropophilic saprotroph that colonizes the upper layers of dead skin, and represents the most common cause of athlete's foot, fungal nail infections, jock itch, and ringworm worldwide . First described by Malmsten in 1845, T. rubrum is currently considered to be a complex of species comprising multiple geographically patterned morphotypes, several of which have been formally described as distinct taxa .

The significance of T. rubrum in molecular biology research stems from:

  • Its genomic complexity and adaptability to human hosts

  • The evolution of strain-specific genetic variations that can be identified through molecular typing

  • Its sophisticated protein regulation system that differs from other dermatophytes despite sharing phylogenetic affiliations

  • The increasing emergence of antifungal resistance, particularly to terbinafine, creating urgent research needs

What molecular techniques are essential for identifying T. rubrum strains prior to ND6 research?

Strain identification of T. rubrum is crucial before conducting specific research on mitochondrial proteins like ND6. Molecular typing can be performed through PCR amplification of the ribosomal DNA nontranscribed-spacer (NTS) region, which contains two novel tandemly repetitive subelements: TRS-1 (containing a 27-bp palindromic sequence) and TRS-2 .

The recommended methodology includes:

  • Genomic DNA extraction followed by RNase treatment to remove RNA contamination

  • PCR amplification using primers designed from conserved regions of fungal 25S and 18S genes:

    • 25S consensus primer (25SCON2): 5′-TAGACCGTCGTGAGACAG-3′

    • 18S primer (NS1-R): 5′-GAGACAAGCATATGACTAC-3′

  • Amplification using long-template PCR systems with appropriate master mix containing:

    • 500 μM deoxynucleoside triphosphates (dNTPs)

    • 300 nM upstream and downstream primers

    • 10-20 ng of template DNA

  • Analysis of strain-characteristic banding patterns (PCR types)

This molecular typing approach has identified 21 distinct TRS-1 PCR types among 101 clinical isolates, providing essential strain differentiation before proceeding with specific protein studies .

How does T. rubrum differ from other dermatophytes in terms of metabolic pathways?

T. rubrum possesses distinct metabolic characteristics compared to other dermatophytes, despite phylogenetic similarities. Key differences include:

  • Protease secretion profile:

    • T. rubrum secretes more than 20 different proteases, including exopeptidases and endopeptidases

    • These proteases have an optimum pH of 8 and are calcium-dependent

    • They allow T. rubrum to efficiently digest human keratin, collagen, and elastin

  • Metabolic enzyme systems:

    • Genetic analyses reveal specialized transporters, heat shock proteins, and metabolic enzymes

    • T. rubrum features a system of up-regulation of key enzymes in the glyoxylate cycle

    • Its protein regulation system is distinctive among dermatophytes

  • Environmental adaptation:

    • T. rubrum demonstrates unique pH sensing abilities that modulate protease secretion

    • Specific peptidases are regulated through alternative splicing mechanisms in the presence of keratin

    • Transcription factors like StuA coordinate expression of virulence-associated genes

These metabolic distinctions may extend to mitochondrial functions including the NADH-ubiquinone oxidoreductase complex, making T. rubrum an important model for studying fungal energy metabolism in the context of host adaptation.

What are the standard growth and maintenance conditions for T. rubrum prior to recombinant protein work?

For optimal growth and maintenance of T. rubrum prior to recombinant protein work, researchers should follow these standardized conditions:

  • Initial culture establishment:

    • Grow T. rubrum on malt extract agar solid medium (2% glucose, 2% malt extract, 0.1% peptone, 2% agar, pH 5.7)

    • Incubate at 28°C for 20 days to achieve adequate sporulation

  • Liquid culture preparation:

    • Inoculate approximately 1 × 10^6 conidia into 100 ml of Sabouraud dextrose broth

    • Incubate cultures at 28°C for 96 hours with agitation (120 rpm)

  • Media switching for specialized studies:

    • Wash resulting mycelia with sterile water

    • Transfer to minimal medium containing appropriate nitrogen sources (e.g., 70 mM sodium nitrate)

    • Add specific substrates of interest (e.g., 0.5% bovine keratin m/v) for induction studies

    • Continue incubation at 28°C with agitation (120 rpm)

  • Harvest and storage:

    • Filter biological material from three independent replicates

    • Store at -80°C until extraction of DNA, RNA, or proteins

These standardized growth conditions ensure reproducibility in subsequent molecular and biochemical analyses of T. rubrum and its recombinant proteins.

What strategies can overcome challenges in expressing recombinant mitochondrial proteins from T. rubrum?

Expressing recombinant mitochondrial proteins from T. rubrum, particularly membrane-bound components like ND6, presents several challenges requiring specialized strategies:

  • Codon optimization approach:

    • Analyze T. rubrum codon usage bias in mitochondrial genes

    • Optimize codons for expression system (bacterial, yeast, or mammalian)

    • Synthesize codon-optimized gene constructs rather than using native sequences

  • Expression system selection:

    • For structural studies: E. coli with specialized membrane protein expression strains (C41, C43)

    • For functional studies: Yeast systems (S. cerevisiae, P. pastoris) that provide eukaryotic processing

    • For protein-protein interaction studies: Mammalian cells with appropriate mitochondrial targeting

  • Fusion protein design:

    • N-terminal fusions: GST, MBP, or SUMO tags to enhance solubility

    • C-terminal tags: His6 or FLAG for purification

    • Inclusion of TEV or PreScission protease sites for tag removal

    • Consider split-protein complementation systems for membrane proteins

  • Membrane protein solubilization:

    • Test multiple detergents (DDM, LMNG, digitonin) for optimal extraction

    • Consider nanodiscs or amphipols for maintaining native-like environment

    • Employ lipid reconstitution for functional studies

These strategies must be empirically optimized for each target protein, with particular attention to maintaining the native structure and function of mitochondrial membrane proteins.

How can researchers investigate the role of alternative splicing in regulating expression of mitochondrial proteins in T. rubrum?

Recent research has revealed that alternative splicing plays a significant role in T. rubrum gene regulation, particularly in response to environmental conditions. To investigate its impact on mitochondrial protein expression:

  • Experimental design:

    • Cultivate T. rubrum under different conditions (standard media, keratin-containing media, co-culture with human keratinocytes)

    • Compare wild-type strains with specific transcription factor mutants (e.g., ΔstuA)

    • Harvest RNA at multiple time points to capture dynamic splicing changes

  • Transcriptome analysis:

    • Perform RNA-sequencing with sufficient depth to detect alternative splicing events

    • Use computational tools specifically designed to identify intron retention events

    • Validate findings by RT-qPCR using primers spanning exon-exon junctions

  • Protein isoform detection:

    • Design antibodies against predicted protein isoforms

    • Use western blotting to confirm presence of alternative protein products

    • Employ mass spectrometry to identify isoform-specific peptides

  • Functional characterization:

    • Express different isoforms as recombinant proteins

    • Compare enzymatic activities, stability, and protein-protein interactions

    • Determine subcellular localization of different isoforms

This approach has already identified two peptidase-coding genes (TERG_00734 and TERG_04614) as targets of alternative splicing in the presence of keratin, suggesting this mechanism may extend to mitochondrial proteins .

What are the methodological considerations for comparing ND6 function between terbinafine-resistant and susceptible T. rubrum strains?

With increasing reports of terbinafine-resistant T. rubrum worldwide , comparing mitochondrial protein function between resistant and susceptible strains requires careful methodological considerations:

  • Strain selection and characterization:

    • Include clinical isolates with confirmed terbinafine resistance profiles

    • Sequence squalene epoxidase genes to identify resistance-associated mutations

    • Verify resistance phenotype through standardized susceptibility testing

    • Include paired susceptible strains from similar sources

  • Mitochondrial isolation protocol:

    • Standardize growth conditions prior to mitochondrial extraction

    • Use differential centrifugation followed by density gradient purification

    • Verify mitochondrial purity through marker enzyme assays

    • Assess membrane integrity before functional assays

  • Enzymatic analysis considerations:

    • Measure NADH-ubiquinone oxidoreductase activity using standardized substrates

    • Control for mitochondrial content differences between strains

    • Assess electron transfer rate and proton pumping efficiency separately

    • Examine potential compensatory changes in other respiratory complexes

  • Data interpretation framework:

    • Distinguish direct effects (altered ND6 expression/function) from indirect effects (metabolic adaptations)

    • Correlate mitochondrial function changes with specific resistance mechanisms

    • Consider potential pleiotropic effects of resistance mutations

This comprehensive approach can reveal whether mitochondrial energy metabolism adaptations contribute to terbinafine resistance in T. rubrum.

How can T. rubrum ND6 be studied in the context of host-pathogen interactions?

Studying T. rubrum ND6 during host-pathogen interactions requires specialized co-culture systems and analytical approaches:

  • Co-culture system development:

    • Culture human keratinocytes (e.g., HaCat cell line) in RPMI medium with 10% fetal bovine serum at 37°C with 5% CO2

    • Prepare T. rubrum at approximately 2 × 10^5 cells/ml for co-culture experiments

    • Establish appropriate infection ratios and time course

  • Gene expression analysis:

    • Extract RNA from co-cultures at multiple time points

    • Employ species-specific primers to distinguish fungal from human transcripts

    • Analyze ND6 expression changes during infection progression

    • Compare wild-type strains with relevant mutants

  • Functional mitochondrial assessment:

    • Use fluorescent probes to monitor mitochondrial membrane potential in living co-cultures

    • Measure oxygen consumption in intact co-cultures

    • Assess ROS production during infection process

    • Compare metabolic profiles of pathogen and host cells

  • Visualization techniques:

    • Apply immunofluorescence with antibodies against ND6 and other mitochondrial proteins

    • Use mitochondria-specific dyes to track organelle dynamics during infection

    • Employ live-cell imaging to monitor real-time changes

This integrated approach can reveal how T. rubrum modulates its energy metabolism during host interaction and whether mitochondrial functions contribute to pathogenesis.

What is the optimal PCR protocol for amplifying the T. rubrum ND6 gene for cloning into expression vectors?

The following optimized PCR protocol is recommended for amplifying the T. rubrum ND6 gene:

  • Primer design considerations:

    • Design primers based on the conserved regions flanking the ND6 gene

    • Include appropriate restriction sites or recombination sequences for cloning

    • Consider adding Kozak sequence for eukaryotic expression or ribosome binding site for prokaryotic expression

    • Optimal primer length: 18-25 nucleotides plus cloning features

  • PCR reaction components:

    • High-fidelity DNA polymerase (e.g., Expand Long Template PCR system)

    • Reaction buffer optimized for GC-rich templates

    • 500 μM deoxynucleoside triphosphates (dNTPs)

    • 300 nM of each primer

    • 10-20 ng of purified genomic DNA template

  • Thermal cycling conditions:

    • Initial denaturation: 94°C for 2 minutes

    • 30-35 cycles of:

      • Denaturation: 94°C for 30 seconds

      • Annealing: 55-58°C for 30 seconds (optimize based on primer Tm)

      • Extension: 68°C for 1 minute per kb of target

    • Final extension: 68°C for 7 minutes

  • Product verification and purification:

    • Analyze PCR product by agarose gel electrophoresis

    • Purify using gel extraction or column-based methods

    • Verify sequence before proceeding to cloning

This protocol builds upon the PCR methodology used for successful amplification of T. rubrum genomic regions but is optimized for the specific requirements of ND6 gene amplification.

What purification strategy yields the highest activity for recombinant T. rubrum mitochondrial proteins?

Purifying recombinant mitochondrial membrane proteins like ND6 while maintaining activity requires a specialized approach:

  • Initial extraction optimization:

    • Test multiple detergents at different concentrations:

      • Mild detergents: DDM (0.5-1%), digitonin (0.5-2%)

      • More stringent detergents: LMNG (0.1-0.5%), FC-12 (0.1-0.5%)

    • Include stabilizing agents: glycerol (10-20%), specific lipids (0.1-0.5 mg/ml)

    • Maintain physiological ionic strength with 100-300 mM NaCl or KCl

  • Multi-step purification strategy:

    • Affinity chromatography (primary capture):

      • Immobilized metal affinity chromatography for His-tagged proteins

      • Include 5-10 mM imidazole in binding buffer to reduce non-specific binding

    • Ion exchange chromatography (intermediate purification):

      • Select appropriate resin based on protein theoretical pI

      • Use shallow salt gradients for optimal separation

    • Size exclusion chromatography (final polishing):

      • Use columns with appropriate fractionation range

      • Include detergent at concentrations above CMC

  • Activity preservation measures:

    • Maintain 4°C throughout purification process

    • Include protease inhibitors in all buffers

    • Add specific cofactors required for ND6 function

    • Consider lipid supplementation or reconstitution

  • Quality control assessments:

    • SDS-PAGE for purity evaluation

    • Western blotting for identity confirmation

    • Mass spectrometry for accurate molecular weight determination

    • Activity assays at each purification stage to track specific activity

This comprehensive purification strategy balances protein yield with preservation of enzymatic activity, crucial for functional studies of mitochondrial proteins.

What experimental approach can determine if T. rubrum ND6 is involved in terbinafine resistance mechanisms?

To investigate potential involvement of ND6 in terbinafine resistance mechanisms, the following experimental approach is recommended:

  • Strain comparison setup:

    • Select terbinafine-resistant clinical isolates and susceptible control strains

    • Characterize resistance levels through standardized minimum inhibitory concentration (MIC) testing

    • Confirm resistance mechanism through squalene epoxidase gene sequencing

  • Gene expression analysis:

    • Culture strains with and without sub-inhibitory terbinafine concentrations

    • Extract RNA and perform RT-qPCR targeting ND6 and related genes

    • Perform RNA-sequencing for global transcriptome analysis

    • Compare expression patterns between resistant and susceptible strains

  • Protein function assessment:

    • Isolate mitochondria from resistant and susceptible strains

    • Measure NADH-ubiquinone oxidoreductase activity using standardized assays

    • Assess mitochondrial membrane potential and ROS production

    • Compare respiratory capacity and efficiency between strain types

  • Genetic manipulation experiments:

    • Create ND6 overexpression strains in susceptible backgrounds

    • Assess whether ND6 overexpression alters terbinafine susceptibility

    • Attempt targeted modification of ND6 expression in resistant strains

    • Monitor resulting changes in terbinafine resistance profiles

  • Data correlation analysis:

    • Correlate ND6 expression/activity with resistance levels across multiple strains

    • Assess relationships between mitochondrial function and known resistance mechanisms

    • Evaluate potential compensatory metabolic pathways

This systematic approach can establish whether mitochondrial functions, particularly those involving ND6, contribute to terbinafine resistance in T. rubrum.

How can researchers establish a reliable co-culture system to study T. rubrum mitochondrial function during host interaction?

Establishing a reliable co-culture system to study T. rubrum mitochondrial function during host interaction requires careful optimization:

  • Cell culture preparation:

    • Maintain immortalized human keratinocyte cell line (HaCat) in RPMI medium supplemented with 10% fetal bovine serum

    • Culture at 37°C in a humidified atmosphere containing 5% CO2

    • Include antibiotics (100 U/ml penicillin and 100 μg/ml streptomycin) to prevent bacterial contamination

  • Fungal preparation:

    • Grow T. rubrum on appropriate solid medium for 20 days at 28°C

    • Harvest conidia and prepare standardized suspension

    • Pre-culture in Sabouraud dextrose broth at 28°C for 96h with agitation (120 rpm)

    • Wash mycelia thoroughly before co-culture to remove media components

  • Co-culture establishment:

    • Seed approximately 2 × 10^5 HaCat cells/ml in six-well plates

    • Allow keratinocytes to adhere and form monolayer (24 hours)

    • Add standardized fungal inoculum at appropriate MOI

    • Incubate at 34-35°C (compromise temperature suitable for both organisms)

  • Analytical methods:

    • Microscopy: Phase contrast and fluorescence for visualizing interactions

    • Viability: MTT assay for keratinocytes, CFU counts for fungi

    • Molecular: Species-specific primers for RT-qPCR

    • Mitochondrial function: Selective fluorescent probes compatible with co-culture

  • Controls and validations:

    • Mono-cultures of each organism at identical conditions

    • Heat-killed fungi to distinguish between contact-dependent and secreted effects

    • Multiple time points to capture dynamic interactions

This approach enables investigation of mitochondrial adaptations during host-pathogen interactions while maintaining viability of both cell types.

What statistical methods are appropriate for analyzing differential expression of mitochondrial genes in T. rubrum under various conditions?

Analysis of differential expression of mitochondrial genes requires robust statistical approaches:

  • RT-qPCR data analysis:

    • Reference gene selection:

      • Test multiple candidate reference genes (e.g., β-tubulin, 18S rRNA, GAPDH)

      • Verify stability using geNorm or NormFinder algorithms

      • Use at least two validated reference genes for normalization

    • Relative quantification using 2^(-ΔΔCt) method

    • Statistical testing:

      • Student's t-test for two-condition comparisons

      • ANOVA with post-hoc tests for multiple conditions

      • Apply Benjamini-Hochberg correction for multiple comparisons

  • RNA-sequencing data analysis:

    • Quality filtering and normalization:

      • Remove low-quality reads and adapter sequences

      • Normalize for sequencing depth and gene length (FPKM/TPM)

    • Differential expression analysis:

      • Use DESeq2 or edgeR packages with appropriate dispersion estimation

      • Apply false discovery rate (FDR) control (q < 0.05)

      • Set biologically meaningful fold-change thresholds (typically ≥1.5-fold)

    • Alternative splicing analysis:

      • Employ specialized tools to detect intron retention and exon skipping

      • Validate with isoform-specific PCR

  • Visualization and interpretation:

    • Heat maps for clustering co-regulated genes

    • Volcano plots to display significance versus fold change

    • Pathway enrichment analysis for biological context

    • Time-course visualization for dynamic responses

These statistical approaches ensure robust identification of differentially expressed mitochondrial genes while controlling for false discoveries.

How should researchers interpret discrepancies between genomic, transcriptomic, and proteomic data for T. rubrum mitochondrial proteins?

When faced with discrepancies between multi-omics datasets for T. rubrum mitochondrial proteins, researchers should apply the following interpretive framework:

  • Technical considerations:

    • Evaluate platform-specific limitations and biases

    • Consider differences in detection sensitivity between methods

    • Assess technical reproducibility across replicates

    • Validate key findings using orthogonal techniques

  • Biological interpretation strategies:

    • Post-transcriptional regulation:

      • Alternative splicing may generate different protein isoforms not predicted from genomic data

      • miRNA regulation might cause transcript-protein discordance

    • Post-translational modifications:

      • Protein processing, especially for mitochondrial proteins with transit peptides

      • Phosphorylation, acetylation affecting protein stability or activity

    • Temporal dynamics:

      • Time delays between transcription and translation

      • Different half-lives of mRNAs versus proteins

  • Integration approaches:

    • Correlation analysis between transcript and protein levels

    • Pathway-level analysis rather than individual gene focus

    • Use of integrative computational frameworks (e.g., DIABLO, mixOmics)

    • Development of causal models to explain observed discrepancies

  • Reporting recommendations:

    • Transparently acknowledge discrepancies in publications

    • Discuss biological implications of different regulatory layers

    • Propose follow-up studies to resolve inconsistencies

    • Contribute findings to T. rubrum-specific databases

This systematic approach transforms apparent discrepancies into opportunities for deeper biological insights about mitochondrial protein regulation in T. rubrum.

How can researchers differentiate between strain-specific and environment-induced variations in T. rubrum mitochondrial protein expression?

Distinguishing between genetic (strain-specific) and environmental influences on mitochondrial protein expression requires careful experimental design:

  • Factorial experimental design:

    • Test multiple strains with distinct PCR types (based on TRS-1 and TRS-2 patterns)

    • Expose each strain to identical environmental conditions

    • Include technical and biological replicates for robust analysis

  • Analysis of variance approach:

    • Two-way ANOVA to partition variance:

      • Strain effect (genetic component)

      • Environment effect (inducible component)

      • Strain × environment interaction

    • Calculate effect sizes (partial η²) to quantify relative contributions

  • Visualization and data presentation:

    ConditionStrain A ExpressionStrain B ExpressionStrain C Expression
    Condition 1Mean ± SDMean ± SDMean ± SD
    Condition 2Mean ± SDMean ± SDMean ± SD
    Condition 3Mean ± SDMean ± SDMean ± SD
  • Molecular validation approaches:

    • For putative strain-specific variations:

      • Sequence analysis of regulatory regions

      • Genetic complementation experiments

    • For environment-induced variations:

      • Time-course analysis after environmental shift

      • Epigenetic profiling (e.g., histone modifications)

This approach allows researchers to quantitatively partition observed variability into genetic and environmental components, guiding subsequent mechanistic studies.

What computational approaches can predict functional consequences of amino acid variations in T. rubrum ND6?

Predicting functional consequences of amino acid variations in T. rubrum ND6 requires specialized computational approaches:

  • Sequence-based prediction methods:

    • Conservation analysis:

      • Multiple sequence alignment across fungal species

      • Calculate conservation scores (e.g., Jensen-Shannon divergence)

      • Identify highly conserved regions likely critical for function

    • Variation impact prediction:

      • SIFT (Sorting Intolerant From Tolerant) analysis

      • PolyPhen-2 for structural and functional predictions

      • PROVEAN (Protein Variation Effect Analyzer)

  • Structural analysis approaches:

    • Homology modeling:

      • Identify suitable templates from related proteins with known structures

      • Build 3D models incorporating T. rubrum-specific sequences

      • Validate models through energy minimization and Ramachandran plots

    • Molecular dynamics simulations:

      • Simulate protein behavior in membrane environment

      • Analyze effects of variations on stability and flexibility

      • Calculate free energy differences between variants

  • Functional domain mapping:

    • Identify critical domains:

      • NADH binding sites

      • Ubiquinone interaction regions

      • Proton translocation pathways

      • Subunit interface regions

    • Assess variation location relative to functional domains

  • Integration with experimental data:

    • Correlate predictions with measured enzyme kinetics

    • Validate key predictions through site-directed mutagenesis

    • Refine computational models based on experimental outcomes

This comprehensive computational approach provides mechanistic hypotheses about how amino acid variations might affect ND6 function, guiding subsequent experimental validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.