Recombinant Trichophyton verrucosum Bifunctional lycopene cyclase/phytoene synthase (TRV_03236)

Shipped with Ice Packs
In Stock

Description

Functional Analysis

Enzymatic Activities

  1. Phytoene Synthase:

    • Catalyzes the dimerization of GGPP to form phytoene, the first committed step in carotenoid biosynthesis .

    • Critical for initiating the pathway toward β-carotene and other terpenoids .

  2. Lycopene Cyclase:

    • Converts linear lycopene into bicyclic β-carotene via two cyclization reactions .

    • Structural studies in fungi (e.g., Mucor circinelloides) confirm this domain requires proper folding for activity .

Heterologous Expression Validation

  • Functional assays in E. coli and yeast demonstrate TRV_03236’s bifunctionality .

  • Co-expression with phytoene dehydrogenase (e.g., carB) enhances β-carotene yield, mimicking natural fungal pathways .

Host Systems and Expression Data

Expression Platforms

HostYield/Purity NotesCitation
E. coliHigh purity (≥85%); scalable for bulk production
YeastCompatible with eukaryotic post-translational modifications
Cell-free SystemsUsed for rapid in vitro characterization

Optimization Challenges

  • The P domain (phytoene synthase) requires precise R domain (cyclase) conformation for activity .

  • Repeated freeze-thaw cycles degrade functionality; storage at -80°C in glycerol is recommended .

Comparative Analysis with Fungal Homologs

TRV_03236 shares functional parallels with bifungal enzymes in other species:

OrganismGeneKey SimilaritiesDifferences
Mucor circinelloidescarRPDomain architecture (R and P domains)Regulatory elements in promoter .
XanthophyllomycescrtYBBifunctional cyclase/synthaseTransmembrane topology .
Neurospora crassaal-2Phytoene synthase activityCyclase domain mutations alter pigmentation .

Research Applications

  • Metabolic Engineering: Used in microbial platforms (e.g., E. coli, yeast) to optimize β-carotene production .

  • Enzyme Mechanism Studies: Domain-swapping experiments to dissect cyclase/synthase interactions .

  • Antifungal Target Exploration: T. verrucosum is a dermatophyte; TRV_03236 inhibitors could disrupt pathogen carotenoid pathways .

Limitations and Future Directions

  • Structural Data: No crystallographic or cryo-EM structures are available for TRV_03236.

  • Thermostability: Performance in industrial bioreactors requires further optimization .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested and an additional fee is agreed upon in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us; we will prioritize its implementation.
Synonyms
TRV_03236; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Trichophyton verrucosum (strain HKI 0517)
Target Names
TRV_03236
Target Protein Sequence
MGLDYLMVHVKYNIPPALLLTILYKPFFTRLEVYKIVFLCTIAVVWTTPWDSYLIRTRVW SYPADSVIGHTIFRIPLEEAFFFIIQTYNTSLIYILFNKRLILLPYLSGPIKPLTQGLFG TVALRTWRDFGILFFTGISVLGISCIRAGGEYMYLGLILSWISPILLLQWPLMYRFLLGL PPASLWVPIVLPTLYLWIVDTLALRRGTWVIESGTKVDIQLWDGLELEEALFFLVTNVMI VLGIAGMDNAIALFEYKAFVSTTAVGETPSIPRLLTLFFTRSRRYCDTNVLREMSQAVTL LKQKSQTMYLGSAMFEGQLRLDLVALYSFCRKADDLIDDAPNRATAQYWIKQCEKALELR FKLKGAALDNTAAYQQLTKSIPPQLHAAVHLLPASRLPKGPLSDLLKGFEIDMKFDSERG IFPIATEHDLEVYAYHVAGTIATLLLELVFRHHPVSISDSERLRVISAGEGMGRALQYTN IARDIVRDAEIGRVYIPSVWLAEQGLTPSMVVNQPRNPKLIPLRRRLLDKAEKCYRDTQE AISELPANVRAPVRATVTVYMDIGQVIRENEMKVWNGKLKVSRWRRFKGAWLAMS
Uniprot No.

Target Background

Function
Recombinant Trichophyton verrucosum Bifunctional lycopene cyclase/phytoene synthase (TRV_03236) is a bifunctional enzyme catalyzing the conversion of geranylgeranyl diphosphate to phytoene (phytoene synthase activity) and lycopene to β-carotene via the intermediate γ-carotene (lycopene cyclase activity).
Database Links
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does the bifunctional nature of this enzyme compare to similar enzymes in other organisms?

The bifunctional nature of TRV_03236 is relatively uncommon but not unique among carotenoid biosynthetic enzymes. Unlike many organisms that possess separate genes for lycopene cyclase and phytoene synthase activities, T. verrucosum has evolved this fusion protein that catalyzes two sequential steps in carotenoid biosynthesis . This arrangement may provide coordinated regulation of these enzymatic activities, potentially enhancing metabolic efficiency. Comparative genomic analyses with other dermatophytes would be needed to determine if this bifunctional arrangement is conserved across related species or represents a unique adaptation in T. verrucosum.

What expression systems have been successfully used for recombinant TRV_03236 production?

Recombinant TRV_03236 has been successfully expressed in E. coli expression systems, particularly when fused with an N-terminal His tag to facilitate purification . The full-length protein (amino acids 1-595) has been produced in this system, suggesting that despite its membrane-associated domains, the complete protein can be expressed in bacterial systems. For researchers attempting expression:

  • Choose a vector system with strong promoter control (e.g., T7 promoter-based systems)

  • Consider codon optimization for E. coli if expression yields are low

  • Test expression at various temperatures (16-30°C) to balance expression rate with proper folding

  • Include solubility-enhancing tags (His tag has been demonstrated effective)

What are the optimal purification and storage conditions for maintaining TRV_03236 activity?

Based on available data for recombinant TRV_03236:

Purification Protocol:

  • Immobilized metal affinity chromatography (IMAC) using the N-terminal His tag

  • Buffer composition: Tris/PBS-based buffer, pH 8.0

  • Addition of 6% trehalose as a stabilizing agent

Storage Recommendations:

  • The purified protein is stable as a lyophilized powder

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% recommended) for long-term storage

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles as they may compromise protein activity

What quality control measures should be implemented when working with recombinant TRV_03236?

For reliable experimental outcomes, implement these quality control measures:

  • Purity assessment: SDS-PAGE analysis (>90% purity is recommended)

  • Identity confirmation: Western blot with anti-His antibodies and/or mass spectrometry

  • Functional activity assay: Spectrophotometric assays to measure:

    • Phytoene synthase activity: monitoring phytoene production

    • Lycopene cyclase activity: measuring conversion of lycopene to β-carotene

  • Thermal stability assessment: Differential scanning fluorimetry to determine stability under various buffer conditions

  • Aggregation analysis: Size exclusion chromatography or dynamic light scattering

What are the key enzymatic activities of TRV_03236 and how can they be measured?

TRV_03236 possesses two distinct enzymatic activities:

Phytoene Synthase Activity:

  • Catalyzes the condensation of two geranylgeranyl diphosphate (GGPP) molecules to form phytoene

  • Measurement method: HPLC detection of phytoene (λmax ≈ 286 nm) following incubation with GGPP substrate

  • Typical assay conditions: 100 mM Tris-HCl (pH 7.6), 5 mM MgCl2, 1 mM DTT, 100 μM GGPP, 1-5 μg purified enzyme

Lycopene Cyclase Activity:

  • Converts lycopene to β-carotene through cyclization reactions

  • Measurement method: HPLC separation and quantification of lycopene and β-carotene

  • Typical assay conditions: 50 mM HEPES (pH 7.8), 0.1% Tween 80, 5 mM MgCl2, 1 mM DTT, lycopene substrate (solubilized in 0.1% Tween 80), 1-5 μg purified enzyme

Both activities should be assayed separately to determine kinetic parameters and potential regulatory interactions between the two catalytic functions.

How can gene expression analysis of TRV_03236 be optimized in experimental research?

For accurate gene expression analysis of TRV_03236 in T. verrucosum:

  • Reference gene selection: The SDHA gene has been identified as the most stable housekeeping gene for T. verrucosum across different culture conditions and is recommended for qRT-PCR normalization . Other potential reference genes include TUBB, ACTB, ADPRF, RPL2, and EEF1A1, although they showed less stability than SDHA .

  • Culture conditions: Gene expression can vary significantly depending on growth media. When studying TRV_03236 expression, consider:

    • Sabouraud medium

    • Potato dextrose medium

    • Keratin-supplemented MM-Cove medium (particularly relevant for pathogenicity studies)

  • RNA extraction protocol: For filamentous fungi like T. verrucosum:

    • Use mechanical disruption with glass beads in combination with TRIzol reagent

    • Include DNase treatment to eliminate genomic DNA contamination

    • Verify RNA integrity by gel electrophoresis or Bioanalyzer

  • qRT-PCR design:

    • Design primers spanning exon-exon junctions where possible

    • Validate primer efficiency using standard curves (90-110% efficiency)

    • Include no-template and no-reverse-transcriptase controls

What experimental approaches can determine the substrate specificity of TRV_03236?

To characterize substrate specificity of this bifunctional enzyme:

  • Substrate analog testing:

    • Test structurally related substrates (GGPP analogs for phytoene synthase activity; lycopene analogs for cyclase activity)

    • Measure relative activity with different substrates using HPLC or LC-MS

  • Site-directed mutagenesis:

    • Identify conserved residues in each catalytic domain through sequence alignment with characterized enzymes

    • Generate point mutations and assess their impact on each enzymatic activity

    • This approach can identify residues critical for substrate binding vs. catalysis

  • Domain swapping experiments:

    • Generate chimeric proteins by swapping domains with related enzymes from other species

    • Evaluate changes in substrate preference and catalytic efficiency

    • This can reveal determinants of substrate specificity beyond the active site

  • Structural studies:

    • Crystallize the enzyme or perform cryo-EM analysis to determine 3D structure

    • Co-crystallize with substrates or substrate analogs to visualize binding interactions

    • Molecular docking studies can predict substrate binding modes

What role might TRV_03236 play in the pathogenicity of Trichophyton verrucosum?

While direct evidence linking TRV_03236 to pathogenicity is limited, several hypotheses can be investigated:

  • Carotenoid biosynthesis and stress protection:

    • Carotenoids protect fungi against oxidative stress

    • TRV_03236, as a key enzyme in carotenoid biosynthesis, may contribute to survival in the harsh environment of the host

    • This could be tested by creating knockout or knockdown T. verrucosum strains and assessing their virulence and stress tolerance

  • Immune modulation:

    • Fungal carotenoids may interact with host immune responses

    • The products of TRV_03236 activity might suppress immune recognition or inflammatory responses

    • Co-culture experiments with immune cells could assess this possibility

  • Cell wall integrity:

    • Carotenoids can be incorporated into fungal membranes, affecting their properties

    • TRV_03236 may indirectly contribute to cell wall integrity and resistance to host defenses

    • Microscopy and cell wall permeability assays could test this hypothesis

How can TRV_03236 be utilized for molecular identification of T. verrucosum in clinical samples?

TRV_03236 offers potential as a diagnostic target for T. verrucosum identification:

  • PCR-based detection:

    • Design species-specific primers targeting unique regions of TRV_03236

    • Nested PCR approaches have shown high sensitivity for dermatophyte detection, with agreement (κ: 0.96) comparable to microscopy for T. verrucosum identification

    • This approach can be particularly valuable for culture-negative samples

  • Multi-locus sequence typing (MLST):

    • Include TRV_03236 alongside established markers (ITS rDNA, gapdh, tubb, tef1α) for improved resolution in phylogenetic analysis

    • This has proven effective for distinguishing between closely related dermatophyte species

  • qRT-PCR quantification:

    • Develop a quantitative assay for TRV_03236 expression

    • Normalize using SDHA as a stable reference gene

    • This approach can assess fungal burden in clinical samples

The table below shows agreement between clinical assessment and laboratory diagnosis methods for T. verrucosum (indicated as "v" category):

CategoryClinical Assessment (n)Positive Microscopy (n)Positive Culture (n)Positive Nested PCR (n)
v4745 κ: 0.96, 0.90–1.0033 κ: 0.70, 0.56–0.8445 κ: 0.96, 0.90–1.00

These data suggest that nested PCR approaches targeting genes like TRV_03236 can achieve diagnostic accuracy comparable to microscopy and superior to culture methods .

How does TRV_03236 expression vary under different antifungal treatments?

This question remains largely unexplored but could be addressed through:

  • Transcriptomic profiling:

    • Treat T. verrucosum with various classes of antifungals (azoles, allylamines, echinocandins)

    • Perform RNA-seq to assess global gene expression changes

    • Quantify TRV_03236 expression changes using qRT-PCR with SDHA normalization

  • Proteomic approach:

    • Use antibodies against recombinant TRV_03236 to quantify protein levels

    • Western blot analysis of fungal extracts before and after antifungal exposure

    • Immunofluorescence microscopy to assess cellular localization changes

  • Enzyme activity assays:

    • Measure phytoene synthase and lycopene cyclase activities in cell extracts

    • Compare enzyme activity levels before and after antifungal treatment

    • Determine if antifungals directly inhibit TRV_03236 activity in vitro

What approaches can be used to investigate the structure-function relationship of TRV_03236?

Several complementary approaches can elucidate structure-function relationships:

  • Homology modeling:

    • Generate structural models based on related enzymes with known structures

    • Predict catalytic residues and substrate binding sites

    • Guide site-directed mutagenesis experiments

  • Enzymatic assays with truncated constructs:

    • Express and purify individual domains

    • Test each domain for its respective activity

    • Investigate whether the domains function independently or require the full protein context

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map dynamic regions and conformational changes upon substrate binding

    • Identify interdomain interactions and allosteric networks

    • This approach doesn't require crystallization and can work with membrane-associated proteins

  • Cryo-electron microscopy:

    • Determine high-resolution structure of the full-length protein

    • Visualize both catalytic domains and their spatial relationship

    • This approach is particularly suitable for challenging proteins like TRV_03236

How can metabolic engineering of the carotenoid pathway involving TRV_03236 be accomplished?

Metabolic engineering strategies targeting TRV_03236:

  • Heterologous expression systems:

    • Express TRV_03236 in carotenoid-producing organisms (e.g., E. coli with complementary carotenoid genes)

    • Assess pathway efficiency and bottlenecks

    • Optimize expression levels and conditions for maximum carotenoid production

  • Protein engineering approaches:

    • Conduct directed evolution to enhance specific enzymatic properties

    • Target improvements in thermostability, substrate specificity, or catalytic efficiency

    • Screen mutant libraries for desirable phenotypes (e.g., altered carotenoid profiles)

  • Pathway reconstruction:

    • Combine TRV_03236 with other carotenoid biosynthetic enzymes

    • Test various combinations and expression levels to optimize flux

    • Analyze pathway intermediates to identify rate-limiting steps

  • CRISPR-Cas9 genome editing in T. verrucosum:

    • Modify the native TRV_03236 gene to alter its properties

    • Create knockout strains to assess phenotypic consequences

    • Introduce promoter modifications to alter expression levels

What computational approaches can predict interactions between TRV_03236 and potential inhibitors?

Advanced computational methods to identify inhibitors include:

  • Structure-based virtual screening:

    • Use homology models or experimental structures of TRV_03236

    • Screen virtual compound libraries against the active sites

    • Rank compounds by predicted binding affinity and interactions

    • Select top candidates for experimental validation

  • Molecular dynamics simulations:

    • Assess stability of predicted protein-ligand complexes

    • Identify conformational changes upon ligand binding

    • Calculate binding free energies for lead optimization

  • Pharmacophore modeling:

    • Identify essential features required for inhibitor binding

    • Generate pharmacophore hypotheses based on substrate interactions

    • Screen for compounds matching the pharmacophore

  • Machine learning approaches:

    • Train models on known inhibitors of related enzymes

    • Use descriptors of molecular properties to predict new inhibitors

    • Implement quantitative structure-activity relationship (QSAR) models

These computational predictions should be followed by biochemical validation using the purified recombinant TRV_03236 protein and enzymatic assays measuring both catalytic activities.

How conserved is TRV_03236 across different strains and species of dermatophytes?

Comparative genomic analysis would involve:

  • Sequence alignment analysis:

    • Compare TRV_03236 sequences across various Trichophyton species and strains

    • Calculate sequence identity and similarity percentages

    • Identify conserved domains and variable regions

    • Use tools like BLAST, Clustal Omega, and MEGA for phylogenetic tree construction

  • Synteny analysis:

    • Examine gene neighborhood conservation across species

    • Determine if the gene location is conserved or subject to genomic rearrangements

    • This can provide insights into functional relationships and evolutionary history

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Correlate selection patterns with functional domains

    • This approach can reveal which protein regions are functionally critical

  • Functional complementation studies:

    • Express TRV_03236 homologs from different species in a model organism

    • Compare their enzymatic activities and substrate preferences

    • This can reveal functional divergence that might not be apparent from sequence alone

What can be learned from comparing TRV_03236 to other bifunctional enzymes in fungal carotenoid biosynthesis?

Comparative enzyme analysis approaches:

  • Phylogenetic analysis of bifunctional carotenoid enzymes:

    • Construct evolutionary trees to understand when and how many times bifunctionality evolved

    • Determine if TRV_03236 represents an ancient fusion or a recent evolutionary innovation

    • Identify the closest monofunctional relatives of each domain

  • Domain architecture analysis:

    • Compare the organization of catalytic and regulatory domains

    • Identify linker regions that might be critical for coordinating the two activities

    • Determine if domain order is conserved across different bifunctional enzymes

  • Comparative biochemistry:

    • Compare kinetic parameters of TRV_03236 with monofunctional enzymes

    • Assess whether bifunctionality enhances catalytic efficiency or regulatory control

    • Test for substrate channeling between the two catalytic domains

  • Structural comparisons:

    • Analyze differences in active site architecture between mono- and bifunctional enzymes

    • Identify structural adaptations that accommodate dual functionality

    • This can guide engineering efforts to create novel bifunctional enzymes

How has the gene encoding TRV_03236 evolved, and what does this reveal about adaptation strategies in dermatophytes?

Evolutionary analysis approaches:

  • Reconstruction of ancestral sequences:

    • Use maximum likelihood methods to infer ancestral sequences

    • Synthesize and test these sequences to understand functional evolution

    • This can reveal the evolutionary trajectory of the enzyme's dual functionality

  • Horizontal gene transfer analysis:

    • Evaluate whether unusual phylogenetic patterns suggest horizontal gene transfer

    • Compare GC content and codon usage with the rest of the genome

    • This can identify potential sources of novel enzymatic functions

  • Gene duplication and fusion analysis:

    • Determine if TRV_03236 arose from duplication and fusion of ancestral genes

    • Map the evolutionary history of domain fusion events

    • This can provide insights into the adaptive value of combining enzymatic functions

  • Correlation with ecological niches:

    • Compare TRV_03236 sequences across dermatophytes with different host preferences

    • Identify adaptive changes correlated with specific host environments

    • This can reveal how carotenoid metabolism contributes to host adaptation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.