Recombinant Trichophyton verrucosum High osmolarity signaling protein SHO1 (SHO1)

What is the genetic organization of the SHO1 gene in T. verrucosum?

The SHO1 gene in T. verrucosum is identified as TRV_04002 in genomic annotations . The gene encodes a protein of 285 amino acids that functions as a high osmolarity signaling protein (osmosensor SHO1). For genetic analysis, researchers should employ PCR amplification using conditions similar to those utilized for dermatophyte gene analysis: initial denaturation at 98°C for 2 minutes, followed by 35 cycles of denaturation at 98°C for 10 seconds, annealing at 54°C for 15 seconds, and extension at 72°C for 1 minute . Sequence analysis should focus on identifying regulatory regions, promoter elements, and potential intron-exon boundaries to understand genetic regulation mechanisms.

What is the amino acid composition and predicted structure of T. verrucosum SHO1?

The full amino acid sequence of T. verrucosum SHO1 is: MARFQMSNLVGDPFALATVSIGMLAWIIGIVSCSIAHTKEVVPNFFWWSIAYQLCVLVGVAVVMGSNTSHIYGTAVVGYAAAGLVCTTFTLDSLVTSKQGARQSAGAGLILLAMTDIVWIFYFGSTSQSGPRAYIDSFAPHKEQPHSYRNSKPISHSYTPRPETTVSSAHPHMYSSAPLSGFETSSPMTGFNPAAASTTGLQPVLGSQTNASTVGGETGEVGQPTEYPYRAKAIYSYEANPDDANEISFTKHEILEVSDVSGRWWQAKKSTGETGIAPSNYLILL . Structural prediction suggests the presence of transmembrane domains consistent with membrane-localized signaling proteins. Bioinformatic analysis should include hydropathy profiling, secondary structure prediction, and homology modeling based on related fungal sensory proteins to identify functional domains critical for osmosensing and signal transduction.

What expression systems are optimal for producing functional recombinant T. verrucosum SHO1?

For successful expression of functional T. verrucosum SHO1, researchers should evaluate both prokaryotic and eukaryotic expression systems. E. coli-based expression using BL21(DE3) or Rosetta strains may be appropriate for initial production, with optimization of the following parameters:

For membrane proteins like SHO1, consider eukaryotic expression systems such as Pichia pastoris or insect cells if E. coli expression yields insoluble protein. Verify expression through western blotting and test functionality through complementation assays in yeast SHO1-deficient strains.

What purification strategies are most effective for SHO1 protein?

Given the membrane-associated nature of SHO1 predicted from its sequence , a specialized purification approach is necessary:

• Cell lysis: Use mild detergents (DDM, LDAO, or OG) to solubilize membrane proteins

• Initial purification: Affinity chromatography using the fusion tag (e.g., Ni-NTA for His-tagged proteins)

• Secondary purification: Size exclusion chromatography to ensure monodispersity

• Quality control: Assess protein purity by SDS-PAGE and structural integrity by circular dichroism

For membrane proteins like SHO1, maintain detergent concentrations above critical micelle concentration throughout purification to prevent aggregation. Consider using fluorescence-based thermal shift assays to identify buffer conditions that maximize protein stability.

How can researchers assess the osmosensing function of T. verrucosum SHO1?

To characterize the osmosensing function of SHO1, implement the following methodological approaches:

• Yeast complementation assays:

  • Transform SHO1-deficient S. cerevisiae strains with T. verrucosum SHO1

  • Evaluate growth restoration under high osmolarity conditions (1-2M NaCl or sorbitol)

  • Compare growth rates and morphological changes against positive and negative controls

• MAPK pathway activation analysis:

  • Expose SHO1-expressing cells to osmotic shock

  • Measure phosphorylation of downstream MAPK components by western blotting

  • Quantify temporal activation patterns under varying osmotic conditions

• Electrophysiological studies:

  • Reconstitute purified SHO1 in liposomes or planar lipid bilayers

  • Measure electrical properties in response to osmotic gradient changes

  • Correlate functional responses with structural predictions

These approaches provide complementary data on SHO1 function, connecting molecular activity to cellular responses under osmotic stress conditions.

What techniques are available for studying SHO1 protein interactions in T. verrucosum?

For comprehensive analysis of SHO1 protein interactions, employ both in vitro and in vivo approaches:

When analyzing results, focus on interactions that are conserved across related dermatophyte species to identify core signaling components versus species-specific adaptations.

How does T. verrucosum SHO1 compare to homologs in other dermatophyte species?

Comparative analysis of SHO1 across dermatophyte species provides insights into functional conservation and adaptation. Apply the following methodology:

• Extract genomic DNA from multiple dermatophyte species using phenol-chloroform extraction

• Amplify SHO1 genes using degenerate primers designed from conserved regions

• Sequence amplicons and align with T. verrucosum SHO1

• Calculate sequence identity and identify variable regions

Preliminary comparisons suggest:

Phylogenetic analysis should incorporate both sequence and functional data to understand how SHO1 evolution correlates with ecological niches and host adaptation patterns.

What evolutionary pressures have shaped SHO1 in the Trichophyton genus?

Evolutionary analysis of SHO1 should examine selection pressures across different functional domains. Methodology should include:

• Calculate dN/dS ratios across the protein sequence to identify regions under purifying or positive selection

• Map conserved regions to predicted functional domains

• Compare evolutionary rates between dermatophytes with different host preferences (anthropophilic vs. zoophilic)

• Correlate sequence evolution with environmental adaptation patterns

Based on T. rubrum population genetics data, dermatophytes tend toward clonal reproduction with limited genetic recombination . This pattern likely influences SHO1 evolution, with adaptive changes occurring primarily through mutation rather than recombination. Pay particular attention to transmembrane regions and sensing domains that directly interact with the external environment.

How might SHO1 contribute to T. verrucosum pathogenicity?

T. verrucosum causes inflammatory mycoses with variable clinical presentations depending on age and exposure patterns . SHO1, as an environmental sensing protein, potentially contributes to pathogenicity through several mechanisms:

• Environmental adaptation:

  • Sensing humidity changes (relevant given the correlation between T. verrucosum infections and annual rainfall )

  • Temperature adaptation during host colonization

  • pH sensing during tissue invasion

• Host factor recognition:

  • Detection of host antimicrobial peptides

  • Sensing of skin surface lipid composition

  • Adaptation to varying osmotic conditions across different body sites

• Morphogenesis regulation:

  • Control of hyphal development during invasion

  • Regulation of virulence factor expression

  • Biofilm formation in chronic infections

The correlation between T. verrucosum infections and environmental humidity particularly suggests that osmosensing pathways play a key role in the infection cycle. Severe cases like hydronephrosis and joint contractures further highlight the importance of understanding virulence mechanisms.

What experimental models are appropriate for studying SHO1 function during infection?

To investigate SHO1's role during infection, implement the following models:

When designing infection experiments, consider age-related differences in T. verrucosum clinical presentations observed in epidemiological studies , with children more frequently presenting with tinea capitis while adults develop skin infections. Include both wild-type and SHO1-deficient strains to assess the protein's specific contribution to pathogenicity.

What methods can be used to create SHO1 knockout strains in T. verrucosum?

Genetic manipulation of dermatophytes requires specialized approaches. Based on techniques used for related species , consider:

• Homologous recombination-based gene targeting:

  • Design constructs with 1-2kb homology arms flanking a selection marker

  • Optimize transformation conditions for T. verrucosum (PEG-mediated or Agrobacterium-mediated)

  • Select transformants on appropriate media (typically containing hygromycin B)

  • Verify gene disruption by PCR and Southern blotting

• CRISPR-Cas9 mediated gene editing:

  • Design guide RNAs targeting exons of the SHO1 gene

  • Optimize delivery methods (protoplast transformation or biolistic delivery)

  • Screen transformants for mutations using PCR and sequencing

  • Characterize mutants for osmotic stress responses

• RNAi-based knockdown:

  • Create hairpin constructs targeting SHO1 mRNA

  • Transform into T. verrucosum

  • Verify reduced expression by qRT-PCR

For all genetic manipulations, careful phenotypic characterization is essential, comparing growth, morphology, and stress responses between mutant and wild-type strains.

What strategies can be employed for conditional expression of SHO1 in T. verrucosum?

For functional studies, conditional expression systems provide valuable tools. Implement the following methodological approaches:

• Inducible promoter systems:

  • Adapt established fungal inducible promoters (e.g., GAL, MET, TET)

  • Create SHO1 fusions under inducible control

  • Optimize induction conditions for T. verrucosum

• Destabilization domain technology:

  • Fuse SHO1 to a destabilization domain (DD)

  • Express in T. verrucosum

  • Control protein levels using stabilizing ligands

• Temperature-sensitive alleles:

  • Generate temperature-sensitive SHO1 mutants

  • Characterize functionality at permissive and restrictive temperatures

When developing these systems, verification of conditional expression is critical using both protein detection methods (western blot) and functional assays (osmotic stress response) to confirm the system's reliability.

How can researchers map the complete SHO1 signaling pathway in T. verrucosum?

To elucidate the SHO1 signaling network, implement a multi-omics approach:

• Phosphoproteomics:

  • Compare phosphorylation profiles between wild-type and SHO1 mutant strains

  • Identify differentially phosphorylated proteins following osmotic stress

  • Use SILAC or TMT labeling for quantitative comparisons

• Transcriptomics:

  • Perform RNA-Seq analysis under varying osmotic conditions

  • Compare gene expression profiles between wild-type and SHO1 mutants

  • Identify transcription factors regulated by the SHO1 pathway

• Genetic interaction mapping:

  • Create double mutants of SHO1 with other signaling components

  • Perform epistasis analysis to determine pathway hierarchy

  • Identify synthetic lethal interactions to reveal redundant pathways

• Computational modeling:

  • Integrate multi-omics data to construct pathway models

  • Validate predictions through targeted experiments

  • Compare with known fungal osmoregulatory pathways

This comprehensive approach allows construction of a detailed signaling network, connecting SHO1 activation to downstream cellular responses.

What is the relationship between SHO1 and mating pathways in Trichophyton species?

The relationship between osmosensing and sexual development in dermatophytes remains largely unexplored. Based on T. rubrum population genetics data , methodological approaches should include:

• Mating type determination:

  • Determine mating type of T. verrucosum isolates using PCR-based methods

  • Compare distribution with T. rubrum, which shows predominance of MAT1-1

  • Assess correlation between mating type and SHO1 sequence variants

• Co-expression analysis:

  • Compare expression of SHO1 and mating-related genes under various conditions

  • Identify potential co-regulation patterns

  • Determine if osmotic stress influences mating pathway expression

• Genetic interaction studies:

  • Create mutants in both SHO1 and mating pathway components

  • Assess phenotypic outcomes of combined mutations

  • Determine if osmotic stress affects mating efficiency

The predominantly clonal nature of T. rubrum populations suggests limited sexual reproduction in clinical isolates, raising questions about the potential interaction between environmental sensing and sexual development pathways in these fungi.

How does environmental adaptation through SHO1 influence T. verrucosum epidemiology?

Epidemiological studies of T. verrucosum show correlation between infection rates and annual rainfall , suggesting a significant role for environmental sensing in transmission and infection. Research methodologies should include:

• Field sampling:

  • Collect environmental and clinical isolates from regions with varying humidity

  • Sequence SHO1 genes to identify potential adaptive variants

  • Correlate SHO1 sequence with geographical and climatic data

• Experimental evolution:

  • Subject T. verrucosum isolates to cycling osmotic conditions

  • Monitor SHO1 sequence changes over generations

  • Assess changes in virulence following adaptation

• Comparative analysis:

  • Compare SHO1 sequences between isolates from different host species

  • Assess correlation between SHO1 variants and host preference

  • Determine if SHO1 polymorphisms correlate with severity of infection

This integrated approach connects molecular mechanisms to population-level patterns, potentially explaining the observed correlation between T. verrucosum infections and humidity levels .

What role might SHO1 play in rare severe manifestations of T. verrucosum infection?

While T. verrucosum typically causes superficial infections, rare severe cases like hydronephrosis and joint contractures have been reported . To investigate SHO1's potential role in these manifestations:

• Isolate characterization:

  • Sequence SHO1 from isolates causing severe disease

  • Compare against isolates from typical superficial infections

  • Identify potential mutations associated with enhanced virulence

• Host-pathogen interaction studies:

  • Assess SHO1-dependent invasiveness in tissue models

  • Determine if SHO1 variants affect inflammatory responses

  • Evaluate ability to survive in deep tissues

• Immune evasion assessment:

  • Compare host immune responses to wild-type and SHO1 mutant strains

  • Determine if SHO1 signaling affects expression of immune evasion factors

  • Assess adaptation to varying osmotic environments in different tissues

Understanding SHO1's role in severe infections could provide insights into predicting and preventing such manifestations, particularly in vulnerable populations.

How can SHO1 research contribute to improved diagnosis of T. verrucosum infections?

Current diagnosis of T. verrucosum involves culture and molecular methods . SHO1 research could enhance diagnostic approaches through:

• Development of SHO1-specific molecular diagnostics:

  • Design PCR primers targeting species-specific regions of SHO1

  • Develop rapid molecular tests for clinical laboratories

  • Create multiplexed assays distinguishing T. verrucosum from other dermatophytes

• Antigen detection systems:

  • Develop antibodies against SHO1 protein

  • Create immunochromatographic tests for rapid diagnosis

  • Implement in point-of-care settings

• Metabolomic signatures:

  • Identify metabolites regulated by SHO1 pathways

  • Develop detection methods for these biomarkers

  • Correlate metabolite profiles with clinical outcomes

These approaches could accelerate diagnosis, particularly beneficial given the slow growth of T. verrucosum in culture (up to 4 weeks) .

What potential does SHO1 hold as a therapeutic target for dermatophyte infections?

As a key regulator of environmental adaptation, SHO1 represents a potential target for antifungal development:

• Structure-based drug design:

  • Use the predicted structure of SHO1 to identify potential binding pockets

  • Screen compound libraries for molecules targeting these sites

  • Validate candidates through functional assays

• Pathway-based inhibition:

  • Target downstream components of the SHO1 signaling pathway

  • Develop combination therapies affecting multiple pathway components

  • Assess synergy with existing antifungals

• Immunomodulatory approaches:

  • Determine if SHO1 signaling affects host immune recognition

  • Develop adjuvant therapies enhancing immune clearance

  • Target host-pathogen interface identified through SHO1 studies

Given the severe manifestations that can occur in some cases , developing targeted therapeutics could significantly improve outcomes, particularly for recalcitrant or invasive infections.