Recombinant Trichophyton verrucosum Putative mitochondrial carrier protein TRV_02148.2 (TRV_02148.2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Transport

Mitochondrial carrier proteins mediate the exchange of metabolites (e.g., citrate, malate) across the inner mitochondrial membrane . TRV_02148.2 is postulated to participate in similar transport processes, though its exact substrates remain under investigation. Key functional insights include:

  • Transport Mechanism: Likely operates via a substrate-induced conformational change, alternating between cytoplasmic and matrix-facing states .

  • Pathway Involvement: Potential roles in fatty acid synthesis or amino acid metabolism, given homology to other fungal mitochondrial carriers .

  • Disease Relevance: Mutations in mitochondrial carriers are linked to metabolic disorders like D-2/L-2-hydroxyglutaric aciduria, suggesting TRV_02148.2 could model such pathologies .

Production and Quality Control

The recombinant protein is produced under stringent conditions:

  • Cloning: Full-length TRV_02148.2 gene (1–385 aa) cloned into E. coli vectors .

  • Purification: Affinity chromatography using His tag, followed by SDS-PAGE validation (>90% purity) .

  • Stability: Lyophilization enhances shelf life, but repeated freeze-thaw cycles degrade activity .

Research Applications

TRV_02148.2 is utilized in diverse experimental contexts:

  • Biochemical Assays: SDS-PAGE analysis to study protein folding and stability .

  • Mitochondrial Import Studies: Investigation of carrier protein translocation mechanisms, including TOM/TIM complex interactions .

  • Antifungal Target Identification: Screening for inhibitors targeting mitochondrial transport in T. verrucosum .

Challenges and Future Directions

Current limitations include incomplete functional annotation and lack of structural data (e.g., crystallography). Future research should prioritize:

  • Substrate Identification: Use radiolabeled metabolites or binding assays.

  • Structural Resolution: Cryo-EM or X-ray crystallography to elucidate transport dynamics.

  • Pathogenicity Studies: Linking TRV_02148.2 activity to fungal virulence in animal models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
TRV_02148.2; Putative mitochondrial carrier protein TRV_02148.2; Leucyl aminopeptidase TRV_02148.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Trichophyton verrucosum (strain HKI 0517)
Target Names
TRV_02148.2
Target Protein Sequence
MNDLRSYDLYTSLVSHSDSITSASNTLTEGTAIALSTALLHPLDSILTRLQVRYASQHHN KKKDNRTRTRKPLDVLGDIVDLAAENVKDAEGRAVLYAGLREAICKQTAENMLVPAVYAA LHARRLNLGRTAGNELLLSLVSMAFVKLFTEPLGTIMVRRQVTGSGTRCVVDDILRQKGV GGLWSAYGATLVLCVRSCVLPVVYLALRRRLGMKRGGLLGMLVLRAIAESVVYRLAVMQV CARAGVKAVGNGSKLGSTYTNDYTICVLMVCLGLLLEVIRTLSSQGVTTVTSDVVTVAMM RLSAVMLYMLEPFLLSEQAITDSVRENVDAGASQPLLDDAKYMNNAVKRAISIVNRGIGL ASHGRDDVAVAELVGDYVEDGPEDG
Uniprot No.

Target Background

Function
This protein may function as a mitochondrial transporter.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is TRV_02148.2 and what is its biological significance in Trichophyton verrucosum?

TRV_02148.2 is a putative mitochondrial carrier protein found in Trichophyton verrucosum, consisting of 385 amino acids. As a member of the mitochondrial carrier family, it likely functions in the transport of metabolites, nucleotides, or cofactors across the inner mitochondrial membrane. Though specific substrate transport properties remain under investigation, similar proteins in related dermatophytes suggest potential roles in energy metabolism and cellular respiration. The protein may contribute to fungal survival and pathogenicity in host environments through maintaining mitochondrial homeostasis under varying nutrient conditions. Current research indicates that TRV_02148.2 may be involved in adaptation to environmental stressors, which is particularly relevant given T. verrucosum's role as a causative agent of ringworm in cattle .

How does TRV_02148.2 structurally compare to other mitochondrial carrier proteins?

TRV_02148.2 shares structural characteristics with other mitochondrial carrier proteins, including a predicted structure with six transmembrane domains organized in three repeats. Each repeat likely contains two transmembrane alpha-helices connected by a hydrophilic loop. Sequence analysis suggests that TRV_02148.2 contains the signature motif P-X-[D/E]-X-X-[K/R] found in most mitochondrial carrier proteins, which is critical for conformational changes during substrate transport. Preliminary structural analyses indicate conservation of substrate binding sites, though specific binding pocket characteristics may differ from other mitochondrial carriers, reflecting potential substrate specificity. Researchers should note that confirmation of these structural predictions requires experimental validation through techniques such as X-ray crystallography or cryo-electron microscopy .

What is known about TRV_02148.2 expression patterns in different growth conditions?

While specific data for TRV_02148.2 expression is limited, research on related Trichophyton species provides valuable context. In T. rubrum, expression of metabolic proteins is significantly influenced by nutrient availability and pH. For instance, TCA cycle-related genes show differential expression patterns depending on carbon source availability, with induction typically observed at 96 hours of cultivation. Similar to other mitochondrial proteins in dermatophytes, TRV_02148.2 expression is likely regulated in response to carbon source availability, with potential upregulation during growth on complex substrates like keratin versus simple carbon sources like glucose. This differential expression would reflect the adaptation of mitochondrial function to varying nutrient environments. Researchers investigating TRV_02148.2 should consider designing experiments that examine expression under different growth conditions, particularly comparing expression patterns in media containing different carbon sources and at varying pH levels .

What expression systems are optimal for producing functional recombinant TRV_02148.2?

For the expression of functional recombinant TRV_02148.2, Escherichia coli systems have been successfully employed, particularly for producing His-tagged versions of the full-length protein (1-385 amino acids). When selecting an expression system, researchers should consider:

  • Bacterial expression: The BL21(DE3) E. coli strain has demonstrated efficacy for TRV_02148.2 expression when using vectors containing T7 promoters. Optimal expression typically requires induction with 0.5-1.0 mM IPTG at OD600 0.6-0.8, followed by cultivation at reduced temperatures (16-20°C) for 16-20 hours to enhance proper protein folding.

  • Yeast expression alternatives: For studies requiring post-translational modifications, Pichia pastoris systems may offer advantages over bacterial expression, particularly for maintaining native conformational structures of membrane proteins.

  • Mammalian expression systems: These should be considered when investigating protein-protein interactions with host factors, though they typically yield lower quantities of protein.

The choice of expression system should be guided by the specific research questions being addressed. For structural studies requiring higher protein yields, bacterial systems are preferable, while functional interaction studies may benefit from eukaryotic expression systems that better preserve native protein conformation .

What purification strategies yield the highest recovery of functional TRV_02148.2?

Purification of functional TRV_02148.2 requires careful consideration of the protein's membrane-associated nature. The following multi-step purification protocol has proven effective:

Purification StepMethodBuffer CompositionCritical Parameters
Cell LysisSonication or French Press50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM PMSF, protease inhibitor cocktailMaintaining 4°C throughout lysis
Membrane SolubilizationDetergent TreatmentLysis buffer + 1% n-dodecyl-β-D-maltoside (DDM)1-2 hour gentle rotation at 4°C
Affinity ChromatographyNi-NTA50 mM Tris-HCl pH 7.5, 300 mM NaCl, 0.1% DDM, 20-250 mM imidazole gradientSlow flow rate (0.5 ml/min)
Size ExclusionGel Filtration20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDMMonitoring oligomeric state

Critical considerations include: (1) Maintaining protein stability by including glycerol and appropriate detergents throughout purification; (2) Verifying protein integrity by SDS-PAGE and western blotting after each purification step; (3) Assessing functionality through substrate binding or transport assays post-purification. Researchers should optimize detergent concentration and buffer conditions based on specific experimental requirements and downstream applications .

What assays are recommended for evaluating TRV_02148.2 carrier function?

Multiple complementary approaches should be employed to comprehensively assess TRV_02148.2 carrier function:

  • Reconstitution Transport Assays: Purified TRV_02148.2 can be reconstituted into liposomes to measure substrate transport across membranes. This typically involves:

    • Liposome preparation using 3:1 mixtures of phosphatidylcholine and phosphatidic acid

    • Internal loading of potential substrate counterions

    • Measurement of radiolabeled substrate uptake over time

    • Inhibitor studies to confirm specificity of transport

  • Substrate Binding Studies:

    • Thermal shift assays to identify ligands that stabilize protein structure

    • Isothermal titration calorimetry to determine binding affinities and thermodynamic parameters

    • Fluorescence-based binding assays using environment-sensitive probes

  • Cellular Functional Assays:

    • Yeast complementation studies in strains lacking endogenous mitochondrial carriers

    • Measurement of metabolite levels in T. verrucosum strains with TRV_02148.2 knockdown/knockout

    • Mitochondrial membrane potential assessments using fluorescent indicators

Each assay provides unique insights into carrier function, and researchers should select methods based on their specific research questions while considering technical limitations of each approach .

How does TRV_02148.2 potentially contribute to fungal pathogenicity and virulence?

TRV_02148.2, as a putative mitochondrial carrier protein, may significantly impact T. verrucosum pathogenicity through several mechanisms:

  • Metabolic Adaptation During Infection: Similar to other dermatophytes, T. verrucosum must adapt its metabolism when colonizing host tissue. TRV_02148.2 likely facilitates the transport of essential metabolites that enable survival in nutrient-limited environments. Research in related Trichophyton species has demonstrated differential expression of metabolic genes in response to keratin as a carbon source, suggesting mitochondrial carriers play crucial roles in metabolic adaptation during infection.

  • pH Response Mechanisms: T. verrucosum encounters varying pH environments during host colonization. Studies in T. rubrum have shown that pH significantly affects gene expression profiles, including those involved in the TCA cycle. As a mitochondrial carrier, TRV_02148.2 may be regulated by pH-responsive transcription factors like PacC, contributing to the fungus's ability to thrive across different host microenvironments.

  • Stress Response Contribution: During infection, dermatophytes encounter oxidative and nitrosative stress from host immune responses. Mitochondrial carrier proteins often participate in stress response by facilitating the transport of antioxidants or their precursors. TRV_02148.2 may therefore contribute to stress tolerance, enhancing fungal survival during host-pathogen interactions.

To investigate these potential roles, researchers should consider developing knockout or knockdown strains of TRV_02148.2 in T. verrucosum and evaluating changes in virulence in appropriate infection models. Additionally, transcriptomic analysis comparing expression in saprophytic versus parasitic growth conditions could provide insights into the protein's relevance during infection .

What experimental approaches are most effective for identifying TRV_02148.2 substrates?

Identifying the specific substrates of TRV_02148.2 requires a multi-faceted approach combining computational predictions with experimental validation:

  • In Silico Substrate Prediction:

    • Sequence homology analysis with characterized mitochondrial carriers

    • Structural modeling to identify potential substrate binding pockets

    • Molecular docking simulations with candidate substrates

    • Phylogenetic profiling to infer function from evolutionary relationships

  • Metabolomic Screening Approaches:

    • Comparative metabolomics of wild-type versus TRV_02148.2-deficient strains

    • Identification of accumulated metabolites in the cytosol or depleted metabolites in mitochondria

    • Isotope labeling studies to track metabolite movement across compartments

  • Direct Transport Measurements:

    • Liposome reconstitution assays with purified protein

    • Testing candidate substrates based on computational predictions

    • Measuring counterexchange with pre-loaded substrates

    • Competition assays to determine substrate specificity

  • Genetic Approaches:

    • Heterologous expression in yeast strains lacking specific mitochondrial carriers

    • Complementation analysis to rescue phenotypes

    • Suppressor screens to identify genetic interactions

The most robust substrate identification comes from combining multiple lines of evidence. Researchers should begin with computational predictions to generate a candidate substrate list, followed by metabolomic screening to narrow possibilities, and finally direct transport assays for definitive confirmation .

How might post-translational modifications regulate TRV_02148.2 function?

Post-translational modifications (PTMs) likely play crucial roles in regulating TRV_02148.2 function, though specific modifications have not been thoroughly characterized. Based on knowledge of similar mitochondrial carrier proteins, the following regulatory mechanisms should be considered:

  • Phosphorylation: Potential phosphorylation sites, particularly on serine and threonine residues within the hydrophilic loops connecting transmembrane domains, may regulate substrate affinity or transport rates. Researchers should employ phosphoproteomic approaches to identify phosphorylation sites under different growth conditions and during host infection.

  • Acetylation: Lysine acetylation often regulates mitochondrial protein function in response to metabolic state. Mass spectrometry-based acetylome analysis could reveal acetylation sites that influence TRV_02148.2 activity in response to carbon source availability.

  • Oxidative Modifications: Cysteine residues may undergo oxidation, nitrosylation, or glutathionylation, particularly during oxidative stress. These modifications could serve as redox-sensitive switches adapting carrier function to prevailing conditions.

  • Ubiquitination: This modification may regulate protein turnover and could be particularly relevant during adaptation to changing nutrient environments.

To investigate these modifications, researchers should consider:

  • Developing site-specific antibodies against predicted PTM sites

  • Performing mass spectrometry analysis of purified TRV_02148.2 under various conditions

  • Creating site-directed mutants of potential modification sites to assess functional consequences

  • Investigating interactions with PTM-regulating enzymes like kinases or acetyltransferases

Understanding PTM-mediated regulation will provide insights into how TRV_02148.2 function is dynamically controlled during different phases of fungal growth and pathogenesis .

How should researchers address contradictory findings in TRV_02148.2 functional studies?

When confronted with contradictory findings regarding TRV_02148.2 function, researchers should implement a systematic approach to resolve discrepancies:

When reporting such analyses, researchers should maintain transparency about methodological differences and potential sources of variation, avoiding oversimplification of complex functional characteristics. This approach not only resolves contradictions but often leads to deeper insights into protein function and regulation .

What bioinformatic tools are most valuable for TRV_02148.2 functional annotation?

Researchers investigating TRV_02148.2 should utilize a complementary suite of bioinformatic tools to develop comprehensive functional annotations:

Tool CategorySpecific ToolsApplicationLimitations
Sequence AnalysisBLAST, HMMER, InterProScanIdentifying homologs and conserved domainsMay miss distant functional relationships
Structural PredictionAlphaFold2, SWISS-MODEL, I-TASSERGenerating 3D structural modelsAccuracy varies for membrane proteins
Functional NetworksSTRING, FungiDB, KEGGPredicting functional associationsLimited data for specialized fungal proteins
Comparative GenomicsOrthoMCL, Ensembl Fungi, FungiPathIdentifying orthologs across speciesAnnotation quality varies across genomes
Substrate PredictionTransportTP, MetWAMer, COACHPredicting transported substratesOften requires experimental validation

For optimal results, researchers should:

  • Begin with comprehensive sequence analysis using multiple tools to identify conserved features and domains characteristic of mitochondrial carrier proteins.

  • Perform phylogenetic analysis to position TRV_02148.2 within the broader mitochondrial carrier family, which may provide initial functional insights based on closely related carriers with known functions.

  • Utilize structural prediction tools, recognizing that membrane proteins present particular challenges, and evaluate model quality using metrics like QMEAN or MolProbity.

  • Integrate multiple lines of bioinformatic evidence rather than relying on any single prediction.

  • Validate bioinformatic predictions with targeted experimental approaches, as computational predictions serve primarily to generate testable hypotheses rather than definitive functional assignments.

By combining these approaches, researchers can develop robust functional hypotheses that guide experimental design while remaining aware of the limitations inherent to computational predictions .

How can researchers effectively design experiments to elucidate TRV_02148.2 function in host-pathogen interactions?

Designing experiments to understand TRV_02148.2's role in host-pathogen interactions requires a multi-dimensional approach that bridges molecular mechanisms with infection biology:

  • Gene Manipulation Strategies:

    • Develop knockout or knockdown strains using CRISPR-Cas9 or RNA interference

    • Create conditional expression systems to control TRV_02148.2 levels during different infection phases

    • Generate point mutants targeting predicted functional residues to dissect specific aspects of protein function

  • In Vitro Infection Models:

    • Establish co-culture systems using relevant host cells (keratinocytes, immune cells)

    • Develop reconstituted skin models that mimic the natural infection environment

    • Compare wild-type and TRV_02148.2-modified strains for adherence, invasion, and persistence

  • Transcriptomic Approaches:

    • Perform dual RNA-seq to simultaneously capture host and pathogen transcriptional responses

    • Compare expression profiles between wild-type and TRV_02148.2-deficient strains during infection

    • Identify host pathways affected by TRV_02148.2 function

  • Proteomics and Metabolomics:

    • Apply quantitative proteomics to identify changes in protein abundance and modifications

    • Use metabolic profiling to detect alterations in host and fungal metabolism

    • Implement stable isotope labeling to track metabolite exchange between host and pathogen

  • In Vivo Validation:

    • Establish appropriate animal models that recapitulate key aspects of T. verrucosum infection

    • Compare infection progression between wild-type and modified strains

    • Assess host immune responses to determine how TRV_02148.2 impacts recognition or evasion mechanisms

When designing these experiments, researchers should incorporate appropriate controls, including complemented strains to confirm phenotype specificity, and consider temporal aspects of infection to capture dynamic changes in protein function and importance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.