Recombinant Trichoplusia ni Acyl-CoA Delta (11) desaturase

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Catalytic Activity

The Δ11 desaturase catalyzes the conversion of saturated fatty acids (e.g., palmitic acid [16:0]) into monounsaturated derivatives (e.g., (Z)-11-hexadecenoic acid [16:1Δ11cis]) by inserting a double bond between carbons 11 and 12 . Key findings include:

  • Substrate Specificity: Preferential activity toward C16:0 and C18:0 acyl-CoA substrates, producing Δ11 monoenes .

  • Product Diversity: Heterologous expression in Saccharomyces cerevisiae demonstrates its ability to synthesize both 16:1Δ11cis and 18:1Δ11cis .

  • Regioselectivity: Unlike other desaturases, Δ11 desaturases exhibit strict positional specificity, distinguishing them from Δ9 or Δ14 desaturases .

Heterologous Expression and Functional Studies

Studies in recombinant systems highlight its biotechnological potential:

Expression HostSubstrateProductYieldReference
Saccharomyces cerevisiae16:0-CoA16:1Δ11cis48% of total FAs
S. cerevisiae18:0-CoA18:1Δ11cis36% of total FAs
S. cerevisiae (Δole1 mutant)16:0-CoA16:1Δ11cis + 18:1Δ11cis84% combined
  • Functional Complementation: Restores growth in S. cerevisiae ole1Δ mutants deficient in endogenous Δ9 desaturase activity .

  • Pheromone Biosynthesis: Critical for producing (Z)-11-tetradecenyl acetate, a major component of T. ni sex pheromones .

Evolutionary and Ecological Significance

  • Gene Family Expansion: T. ni Δ11 desaturase belongs to the "First Desaturase" subfamily (Desat A1), which underwent lineage-specific duplications in Lepidoptera .

  • Role in Chemical Communication: Diversification of Δ11 desaturases correlates with speciation in moths, enabling species-specific pheromone blends .

  • Cryptic Homologs: Retroposon-linked Δ11-desaturase genes (e.g., ezi-Δ11 in Ostrinia spp.) suggest ancient gene duplication events and neofunctionalization .

Applications in Biotechnology

  • Pheromone Synthesis: Recombinant Δ11 desaturases enable sustainable production of insect pheromones for eco-friendly pest control .

  • Fatty Acid Engineering: Used in metabolic engineering to produce novel unsaturated fatty acids for industrial applications .

Comparative Insights from Related Species

  • Rhizophagus irregularis DES2: A fungal Δ11 desaturase homologous to T. ni enzyme, producing 16:1Δ11cis in yeast .

  • Ostrinia latipennis LATPG1: A strict Δ11 desaturase with no Z-isomer production, contrasting with bifunctional Z/E11-desaturases in other moths .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own applications.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
D11DS; PGD11DS; Acyl-CoA Delta(11 desaturase; Acyl-CoA Delta-11 desaturase; Delta(11-desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-349
Protein Length
full length protein
Species
Trichoplusia ni (Cabbage looper)
Target Names
D11DS
Target Protein Sequence
MAVMAQTVQETATVLEEEARTVTLVAPKTTPRKYKYIYTNFLTFSYAHLAALYGLYLCFT SAKWETLLFSFVLFHMSNIGITAGAHRLWTHKTFKAKLPLEIVLMIFNSLAFQNTAITWA REHRLHHKYSDTDADPHNASRGFFYSHVGWLLVKKHPDVLKYGKTIDMSDVYNNPVLKFQ KKYAVPLIGTVCFALPTLIPVYCWGESWNNAWHIALFRYIFNLNVTFLVNSAAHIWGNKP YDKSILPAQNLLVSFLASGEGFHNYHHVFPWDYRTAELGNNFLNLTTLFIDFCAWFGWAY DLKSVSEDIIKQRAKRTGDGSSGVIWGWDDKDMDRDIKSKANIFYAKKE
Uniprot No.

Target Background

Function
Catalyzes the formation of Delta(11) fatty acyl precursors in the pheromone gland.
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Adult female pheromone gland. Increases by two or three orders of magnitude during the first 2 days after adult eclosion.

Q&A

How does the catalytic function of T. ni Delta(11) desaturase differ from Delta(9) desaturases?

Unlike the metabolic Delta(9) desaturases that primarily function in fatty acid metabolism and cell membrane fluidity regulation, the T. ni Delta(11) desaturase has evolved a specialized function in sex pheromone biosynthesis. The key functional differences include:

CharacteristicT. ni Delta(11) DesaturaseT. ni Delta(9) Desaturase
Primary functionSex pheromone biosynthesisFatty acid metabolism, membrane fluidity
Substrate preferenceProduces Z11-14:Me, Z11-16:Me, Z11-18:Me, Z11-20:Me (1:48:36:15 ratio)Produces delta 9-16 and delta 9-18 in 1:6 ratio
Tissue expressionPredominantly in pheromone glandsWidespread in various tissues
Byproduct formationForms 11-hydroxylated byproducts (~0.1%)Not reported
Evolutionary originSpecialized from ancestral desaturaseConserved across numerous organisms

The Delta(11) desaturase specifically introduces double bonds at the 11th carbon position, whereas Delta(9) desaturases introduce them at the 9th position. This regioselectivity is crucial for producing the specific unsaturated fatty acids needed for pheromone synthesis .

Expression Systems and Methodologies

Characterizing the activity of recombinant T. ni Delta(11) desaturase requires specialized analytical techniques:

  • Gas Chromatography-Mass Spectrometry (GC-MS): The gold standard for analyzing fatty acid methyl esters (FAMEs) produced by desaturase activity. This approach allows researchers to identify both the major products and minor byproducts .

  • Dimethyl Disulfide (DMDS) Derivatization: Essential for confirming double bond positions in monounsaturated products. DMDS derivatives exhibit characteristic mass spectral fragments that reveal the position of unsaturation. For Delta(11) desaturases, fragments indicating a double-bond position between C11-C12 should be observed .

  • Trimethylsilyl (TMS) Derivatization: Particularly important for detecting and characterizing hydroxylated byproducts. The position of hydroxyl groups can be determined through characteristic mass spectral fragmentation patterns of the TMS derivatives .

  • Methyl 4,4-dimethyloxazoline (MTAD) Adducts Analysis: Useful for analyzing conjugated dienes that may form as intermediates in the desaturation process .

A comprehensive analysis workflow should include:

  • Fatty acid extraction from expression system

  • Methylation to form FAMEs

  • GC-MS analysis of underivatized FAMEs

  • Preparation and analysis of DMDS derivatives

  • Additional derivatization methods for specific analyses (TMS, MTAD)

These methods allow researchers to quantify the ratio of different products (e.g., Z11-14:Me, Z11-16:Me, Z11-18:Me) and detect minor byproducts like 11-hydroxylated fatty acids .

How can researchers investigate the mechanism of 11-hydroxylation byproduct formation?

The Delta(11) desaturases from T. ni and S. littoralis have been shown to produce minor 11-hydroxylated byproducts (~0.1% of total fatty acids). Investigating this phenomenon requires specialized approaches:

The level of 11-hydroxylation appears insensitive to the mode of desaturase expression (constitutive vs. induced) and the presence or absence of a b5-fusion domain, suggesting this is an intrinsic property of the enzyme's mechanism .

What approaches help resolve conflicting data on substrate specificity?

Researchers investigating substrate specificity of T. ni Delta(11) desaturase may encounter conflicting results due to experimental variations. A systematic approach includes:

  • Standardized Substrate Panels: Test a consistent panel of potential substrates (C14:0, C16:0, C18:0, etc.) under identical conditions.

  • Cross-Validation with Multiple Expression Systems:

    • Compare results from yeast expression systems (e.g., InvSc1, ole1, ole1 elo1)

    • Validate with in vitro assays using purified enzyme

    • Consider insect cell expression for more native conditions

  • Quantitative Analysis Protocol:

    • Use internal standards for accurate quantification

    • Report ratios of products (e.g., Z11-14:Me, Z11-16:Me, Z11-18:Me, Z11-20:Me in 1:48:36:15 ratio)

    • Include positive controls with known desaturases (e.g., Z9-desaturase from H. assulta)

  • Controlling Variables That Affect Specificity:

    • Expression levels (using inducible promoters with defined induction conditions)

    • Growth phase of expression host

    • Temperature during expression and assay

    • Cofactor availability (especially iron)

When reporting results, researchers should clearly document all methodological details and acknowledge the specific expression system used, as this significantly impacts the observed substrate specificity profile .

How does T. ni Delta(11) desaturase relate evolutionarily to other insect desaturases?

The evolutionary context of T. ni Delta(11) desaturase reveals important insights about pheromone biosynthesis in Lepidoptera:

  • Phylogenetic Positioning: Evolutionary analyses have identified two ditrysian-specific lineages of desaturases (the Δ11 and Δ9 (18C>16C)) that have orthologs in primitive moths despite being absent in Diptera and other insect genomes. This suggests that the Δ11 desaturase lineage represents a novel gene subfamily that was recruited specifically for pheromone production in Lepidoptera .

  • Structural Conservation and Divergence: While T. ni Delta(11) desaturase shares significant homology with metabolic Delta(9) desaturases (72% and 58% similarity to rat and yeast Delta(9) desaturases, respectively), it has evolved unique regioselectivity. The conserved histidine-rich motifs implicated in iron-binding and catalysis are maintained, suggesting that the ancestral catalytic mechanism has been preserved while substrate positioning has evolved .

  • Comparative Sequence Analysis:

    • Core catalytic domains show higher conservation than terminal regions

    • Transmembrane topology appears conserved despite functional divergence

    • Substrate-binding regions show the greatest divergence between Delta(9) and Delta(11) desaturases

This evolutionary context helps researchers understand how novel enzyme functions evolve and provides insights for engineering desaturases with desired specificities .

What structural features distinguish pheromone desaturases from metabolic desaturases?

Understanding the structural differences between pheromone desaturases (like T. ni Delta(11)) and metabolic desaturases is crucial for structure-function studies:

While both types of desaturases share conserved catalytic mechanisms involving iron coordination through histidine-rich motifs, the substrate-binding regions have diverged to accommodate different substrate positions for desaturation. This evolutionary adaptation has allowed pheromone desaturases to produce the specific unsaturated fatty acids needed for species-specific pheromone blends .

How can researchers address issues with heterologous expression of recombinant T. ni Delta(11) desaturase?

Expression difficulties with T. ni Delta(11) desaturase are common and require systematic troubleshooting:

  • Expression System Selection:

    • If pYES2.1 system fails (as observed with some constructs), try copper-inducible pYEX system

    • Consider specialized yeast strains (ole1 or ole1 elo1) for functional expression

    • E. coli expression may require optimization of codon usage and solubility tags

  • Protein Stability Considerations:

    • Store purified protein with 5-50% glycerol (optimally 50%)

    • Aliquot and store at -20°C/-80°C to avoid freeze-thaw cycles

    • Reconstitute lyophilized protein to 0.1-1.0 mg/mL in appropriate buffer

  • Activity Preservation Protocol:

    • Include appropriate cofactors (especially iron)

    • Consider adding reducing agents to prevent oxidation

    • Maintain optimal pH and ionic conditions

  • Expression Verification Methods:

    • Western blot with anti-His antibodies (for His-tagged constructs)

    • Functional complementation in desaturase-deficient yeast

    • RT-PCR and Northern blot to verify transcription

If expression levels remain low, researchers might consider alternative approaches such as different fusion tags, codon optimization, or expression in insect cell systems that may better accommodate the native folding requirements of the enzyme .

What approaches can resolve problems with product detection in desaturase assays?

Detecting the products of T. ni Delta(11) desaturase activity can be challenging, particularly for minor products and byproducts:

  • Enhanced Extraction Protocol:

    • Optimize solvent systems for complete extraction of fatty acids

    • Consider sequential extractions with increasing polarity solvents

    • Use internal standards for quantification and recovery assessment

  • Derivatization Strategy:

    • For double bond positions: Prepare DMDS derivatives

    • For hydroxylated products: Use TMS derivatization

    • For conjugated dienes: Consider MTAD adduct analysis

  • Instrumental Optimization:

    • Use split/splitless injection with optimized temperature program

    • Consider chemical ionization for enhanced molecular ion detection

    • Implement selective ion monitoring for minor components

  • Data Analysis Approach:

    • Search specifically for characteristic fragments (e.g., m/z 194 for Δ11 DMDS derivatives)

    • Implement deconvolution algorithms for overlapping peaks

    • Compare with authentic standards when available

When studying hydroxylated byproducts, researchers should be particularly vigilant as these represent only ~0.1% of total fatty acids. The position of hydroxyl groups can be confirmed by characteristic mass spectral fragmentation patterns of TMS derivatives .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.