Recombinant Triticum aestivum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Triticum aestivum (Wheat)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLAFQSYRPDKKNILVIGPVPG KKYSEIVFPILSPDPATKKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVR KILRKEKGGYEISIVDASDGRQVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its functional role in Triticum aestivum?

Apocytochrome f is the protein product of the chloroplast-encoded petA gene in wheat (Triticum aestivum). It serves as the precursor to cytochrome f, a critical component of the cytochrome b6f complex in the thylakoid membrane electron transport chain. The mature protein participates in the electron transfer between photosystem II and photosystem I during photosynthesis.

In wheat, this protein has a well-characterized amino acid sequence of 285 residues (in the mature form, positions 36-320) and contains characteristic motifs including heme-binding sites. The protein's structure includes regions specifically adapted for electron transport functions within the photosynthetic apparatus .

Based on empirical data, the following protocol is recommended for optimal stability:

Storage:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Avoid repeated freeze-thaw cycles

  • For extended storage, maintain at -80°C

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution:

  • Briefly centrifuge vial prior to opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is standard)

  • Aliquot for long-term storage at -20°C/-80°C

Buffer Composition:
The recommended storage buffer is Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

What methodologies are most effective for optimizing expression and purification of recombinant Apocytochrome f for structural studies?

Successful high-yield production of functional Apocytochrome f requires careful optimization of several parameters:

Expression Optimization Strategies:

  • Strategic construct design: Full-length mature protein (residues 36-320) with N-terminal His-tag typically yields best results for structural studies

  • Temperature modulation: Reducing growth temperature (16-18°C) during induction improves protein folding, particularly for disulfide bond formation

  • Induction optimization: Lower IPTG concentrations (0.1-0.5 mM) and extended induction times improve yield of properly folded protein

Purification Protocol Refinements:

  • Initial IMAC purification using Ni-NTA resin under native conditions

  • Buffer optimization containing reducing agents (5mM DTT) to maintain protein stability

  • Size exclusion chromatography as a polishing step, preferably using Tris-based buffers at pH 8.0

The critical factor affecting structural studies is protein homogeneity. Researchers should verify protein quality via SDS-PAGE (>90% purity) before proceeding to structural characterization .

How do different N-terminal and C-terminal tags affect the functionality and stability of recombinant Apocytochrome f?

Research has revealed significant tag-dependent effects on Apocytochrome f functionality:

Tag TypePositionEffect on StabilityEffect on FunctionRecommended Use Case
His-tagN-terminalEnhanced solubilityMinimal interferenceGeneral research, structural studies
His-tagC-terminalModerate solubilityPotential interferenceNot recommended
GST-tagN-terminalGreatly enhanced solubilitySignificant interference with native foldingProtein-protein interaction studies
BRIL fusionC-terminalEnhanced thermostabilityMaintains functionCrystallography applications

Evidence from recombinant protein studies demonstrates that N-terminal His-tags provide optimal yield and functionality for Apocytochrome f. This configuration allows for proper folding while facilitating single-step purification. The tag position significantly impacts yield, with N-terminal positioning showing consistently better results compared to C-terminal tagging .

What are the critical differences between bacterial and plant cytochrome c biogenesis that affect recombinant Apocytochrome f production?

Understanding the fundamental differences between bacterial and plant cytochrome biogenesis systems is crucial for optimizing recombinant production:

Key Differences:

  • Heme attachment mechanism: Plant systems utilize HCCS (holocytochrome c synthase) while bacterial systems employ CcsBA. These systems have distinct cofactor requirements and operating conditions.

  • Redox requirements: In vitro reconstitution studies have demonstrated that the human HCCS system requires aerobic conditions for initial steps, while bacterial CcsBA functions better under anaerobic conditions, suggesting different electron transfer mechanisms .

  • Substrate recognition: Bacterial and plant systems recognize different structural elements in apocytochromes:

FeaturePlant HCCS SystemBacterial CcsBA System
Recognition motifCXXCHCXXCH with additional elements
Heme bindingPost-translationalCo-translational
ProcessingRequires signal peptide cleavageDoes not require processing

These differences significantly impact recombinant production strategies. For functional studies, E. coli expression systems must be carefully optimized to accommodate these differences, potentially requiring co-expression of chaperones or modified growth conditions .

How can recombinant Apocytochrome f be utilized to study photosynthesis regulation in wheat breeding programs?

Recombinant Apocytochrome f serves as a valuable tool for investigating photosynthetic efficiency in wheat breeding:

Research Applications:

  • Structure-function analysis: Site-directed mutagenesis of recombinant Apocytochrome f allows researchers to assess how specific amino acid changes affect electron transport rates, providing insights for targeted breeding approaches.

  • Protein-protein interaction studies: Using recombinant Apocytochrome f in pull-down assays or yeast two-hybrid screens can identify novel interaction partners within the photosynthetic apparatus.

  • Genetic transformation: Recombinant Apocytochrome f variants can be introduced into wheat via Agrobacterium-mediated transformation (efficiency up to 25% reported) to evaluate their effects on photosynthetic performance under field conditions .

Practical Implementation:
For wheat improvement programs, researchers can leverage recombinant Apocytochrome f studies by:

  • Screening germplasm collections for natural variants with enhanced photosynthetic efficiency

  • Designing targeted modifications based on structure-function relationships

  • Developing high-throughput phenotyping assays using recombinant protein interactions

Recent advances in wheat transformation systems have made it feasible to translate findings from recombinant protein studies directly into crop improvement efforts .

What are the methodological challenges in analyzing the interaction between Apocytochrome f and phytochrome signaling pathways in wheat?

Recent research has uncovered complex relationships between photosynthetic components and light signaling pathways, presenting several methodological challenges:

Technical Challenges and Solutions:

  • Temporal expression coordination:
    Studies have revealed that wheat phytochromes (particularly PHYB and PHYC) regulate flowering time and photosynthetic gene expression. Investigating these interactions requires:

    • RNA-seq analysis under different light conditions

    • Precise sampling timepoints to capture pathway dynamics

    • Normalization strategies to account for circadian effects

  • Mutant analysis complexity:
    Wheat's hexaploid nature complicates genetic studies. Researchers should employ:

    • TILLING mutant resources for phytochrome genes

    • RNA-seq comparisons between phyB-null and phyC-null mutants

    • Analysis of 82 commonly regulated genes identified in both mutants

  • Signaling pathway crosstalk:
    Evidence suggests complex interactions between photosynthetic components and hormone signaling:

    • Phytochrome-regulated genes are enriched in auxin, gibberellin, and brassinosteroid pathways

    • Stress response genes show differential regulation in phytochrome mutants

    • Methodological approaches must incorporate multi-pathway analyses

The most effective research strategies combine protein-level studies using recombinant Apocytochrome f with whole-plant phenotyping and transcriptomic analysis to elucidate these complex regulatory networks .

What methodological approaches can be used to study the maturation process of Apocytochrome f in wheat chloroplasts?

Investigating Apocytochrome f maturation requires specialized techniques addressing the complex multi-step biogenesis process:

Experimental Approaches:

  • In vitro reconstitution systems:

    • Combine purified components (Apocytochrome f, heme, processing peptidase)

    • Monitor conversion to holocytochrome f spectroscopically (550 nm absorbance)

    • Assess heme attachment via heme-staining of SDS-PAGE gels

  • Site-directed mutagenesis strategies:

    • Target consensus cleavage site for thylakoid processing peptidase (e.g., AQA sequence)

    • Modify cysteinyl residues responsible for heme ligation

    • Create truncation variants to study domain-specific effects

  • Pulse-chase analysis:

    • Track rates of synthesis and degradation of various forms

    • Investigate the role of C-terminal membrane anchor in regulating synthesis rates

    • Characterize the proteolytic systems associated with thylakoid membranes

Research has demonstrated that heme binding is not a prerequisite for cytochrome f processing, and pre-apocytochrome f can adopt a conformation suitable for heme lyase activity. These findings suggest parallel rather than strictly sequential processing steps .

How can genetic variability in the petA gene be leveraged for wheat improvement programs?

The petA gene represents an underexplored target for crop improvement efforts:

Strategic Approaches:

  • Genetic diversity assessment:

    • Screen wheat germplasm collections for natural petA variants

    • Employ microsatellite markers linked to photosynthetic efficiency traits

    • Evaluate F3 populations for heritability of photosynthesis-related traits

  • Targeted breeding approaches:
    Recent studies have identified promising wheat genotypes with high heritability estimates:

    Cross CombinationHeritability EstimateGenetic AdvanceTrait Impact
    Watan × Janbaz0.82-Productive traits
    Fakhr-e-Sarhad × AUP-50080.8732.71Productive traits
    Pirsabak-2005 × AUP-50080.88-Productive traits
    Watan × Tatara0.8834.24Productive traits
    Barsat × Tatara0.89-Productive traits

    These combinations show promise for developing lines with enhanced photosynthetic efficiency .

  • Transformation-based approaches:

    • Agrobacterium-mediated transformation systems achieve up to 25% efficiency

    • Can be used to introduce optimized petA variants

    • Enable CRISPR-Cas9 based genome editing of photosynthetic components

The integration of traditional breeding with modern genetic tools offers the most promising path for leveraging petA variability in wheat improvement programs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.