Recombinant Triticum aestivum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression System:

  • Host: Escherichia coli with N-terminal His-tag for affinity purification .

  • Yield: Typically 0.5–1 mg/L culture, depending on induction conditions .

Table 2: Key Applications

ApplicationExample StudySource
Enzyme KineticsProton transport assays
Structural BiologyCryo-EM of CF₀-CF₁ interactions
Antibody DevelopmentImmunogen for anti-AtpA/AtpI antibodies
Stress ResponseDrought-induced RNA editing analysis

Case Study:
In Triticum aestivum cultivars, RNA editing in mitochondrial atp1 (homologous to chloroplast atpI) was found to adjust under drought stress, though synonymous edits did not alter protein structure . This highlights evolutionary conservation of ATP synthase subunits’ functional plasticity.

Comparative Analysis with Orthologs

Table 3: Cross-Species Conservation

SpeciesSubunit a Identity (%)Functional Divergence
Arabidopsis thaliana85%Redox regulation mechanisms
Zea mays82%Enhanced pmf modulation
Chlamydomonas reinhardtii78%Altered redox regulation

Challenges and Future Directions

  • Heterologous Expression: Low solubility of transmembrane domains in E. coli requires optimized detergent buffers .

  • Structural Insights: Full-length structural data remain limited, necessitating advanced cryo-EM studies.

  • Biotechnological Potential: Engineering atpI for improved photosynthetic efficiency in crops .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to fulfill your specific needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Triticum aestivum (Wheat)
Target Names
atpI
Target Protein Sequence
MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVVIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVIPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
ATP synthase subunit a is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of ATP synthase subunit a in wheat chloroplasts?

ATP synthase subunit a in wheat chloroplasts is a critical component of the ATP synthase complex (F₀F₁-ATP synthase) embedded in the thylakoid membrane. This subunit forms part of the membrane-bound F₀ portion of the enzyme complex and plays an essential role in proton translocation across the membrane. The subunit facilitates the conversion of the proton gradient established during photosynthesis into mechanical energy that drives ATP synthesis.

Unlike its mitochondrial counterpart that is involved in oxidative phosphorylation, the chloroplastic ATP synthase subunit a specifically participates in photophosphorylation, utilizing the proton gradient generated during the light-dependent reactions of photosynthesis. The protein structure features multiple transmembrane domains that form a proton channel, crucial for energy conversion efficiency in wheat photosynthesis.

How can researchers differentiate between effects on chloroplastic versus mitochondrial ATP synthase in wheat studies?

Differentiating between effects on chloroplastic versus mitochondrial ATP synthase in wheat requires multiple methodological approaches:

  • Subcellular fractionation: Implement differential centrifugation techniques to isolate intact chloroplasts and mitochondria separately before analysis. This prevents cross-contamination between organellar fractions that could confound results.

  • Organelle-specific inhibitors: Utilize oligomycin as a mitochondrial ATP synthase inhibitor versus tentoxin as a chloroplastic ATP synthase inhibitor in parallel experiments to distinguish organelle-specific effects.

  • Protein-specific antibodies: Employ antibodies that specifically recognize chloroplastic atpI versus mitochondrial ATP1 (as studied in drought stress conditions in Triticum aestivum cultivars) .

  • Gene expression analysis: Monitor transcript levels of chloroplast-encoded atpI versus nuclear-encoded mitochondrial ATP synthase components using RT-PCR or RNA-seq approaches similar to those used for studying mitochondrial atp1 in drought stress research .

  • Spectroscopic differentiation: Measure activity using different wavelengths that preferentially detect chloroplast activity (680nm, 700nm) versus mitochondrial activity.

The research on mitochondrial atp1 gene in wheat cultivars under drought stress provides a methodological template that can be adapted for studying chloroplastic ATP synthase, while accounting for the different genetic origins and regulatory mechanisms .

How does RNA editing affect the functionality of chloroplastic ATP synthase subunit a in wheat?

RNA editing is a post-transcriptional modification process that can significantly alter protein functionality through specific nucleotide changes in transcripts. In wheat chloroplastic ATP synthase, RNA editing sites may influence:

  • Protein structure modifications: Strategic C-to-U transitions can alter amino acid identity, potentially affecting protein folding and stability. Similar to what was observed in mitochondrial atp1 transcripts where RNA editing led to synonymous amino acids in drought-tolerant wheat cultivars .

  • Functional adaptation mechanisms: RNA editing patterns in chloroplastic atpI may represent adaptive responses to environmental stressors, similar to the differential RNA editing observed between drought-tolerant Giza168 and drought-sensitive Gemmiza10 wheat cultivars for mitochondrial atp1 .

  • Organelle-specific editing patterns: Unlike mitochondria where extensive RNA editing occurs (11 sites detected in Giza168 mitochondrial atp1), chloroplastic transcripts typically undergo fewer editing events, which makes each editing site potentially more significant for functionality .

Research methodology should include:

  • Comparative transcript sequencing across different wheat cultivars and growth conditions

  • Structural modeling of edited versus non-edited protein products

  • Functional assessment of ATP synthase with modified editing patterns through site-directed mutagenesis

  • Analysis of editing site conservation across related species

The methodological approach used to identify the 11 RNA editing sites in mitochondrial atp1 of Giza168 and 6 sites in Gemmiza10 provides a valuable framework that can be adapted for studying chloroplastic atpI editing .

What methodological approaches are most effective for studying the impact of environmental stressors on chloroplastic atpI expression and function in wheat?

Environmental stressors significantly affect photosynthetic efficiency in wheat, potentially through modifications to ATP synthase function. Based on research methodologies:

Effective methodological approaches include:

  • Controlled stress experiments:

    • Implement precise drought conditions using polyethylene glycol solutions at defined osmotic potentials

    • Apply heat stress through controlled growth chambers with programmable temperature gradients

    • Design salt stress experiments with incremental NaCl concentrations

    • Monitor photosynthetic parameters using PAM fluorometry at each stress level

  • Time-course analysis:

    • Collect samples at multiple time points (e.g., control, 2-hour, and 12-hour intervals as demonstrated in drought stress studies of mitochondrial atp1)

    • Process parallel samples for transcript analysis, protein quantification, and functional assays

  • Multi-omics integration:

    • Combine transcriptomics (RNA-seq) for atpI expression profiling

    • Implement proteomics to track post-translational modifications

    • Utilize metabolomics to correlate ATP levels with stress responses

  • Cultivar comparison studies:

    • Select contrasting wheat varieties based on stress tolerance (similar to the Giza168 vs. Gemmiza10 comparison for drought tolerance)

    • Analyze differential expression and protein modifications between tolerant and sensitive cultivars

  • In situ activity measurements:

    • Develop protocols similar to those used in the Helium-Neon laser irradiation studies of wheat mitochondria, but adapted for chloroplasts

    • Measure ATP synthesis rates using luciferine/luciferase continuous monitoring systems

    • Track membrane potential with fluorescent probes analogous to safranine

What are the optimal conditions for expression and purification of recombinant Triticum aestivum ATP synthase subunit a, chloroplastic?

Optimal expression and purification protocol:

  • Expression system selection:

    • E. coli BL21(DE3) strain with pET vector systems for chloroplastic membrane proteins

    • Alternatively, wheat germ cell-free expression systems for plant proteins that may be toxic to bacterial cells

    • Consider codon optimization for wheat-derived sequences to improve expression efficiency

  • Expression conditions optimization:

    ParameterRecommended RangeOptimization Notes
    Temperature16-20°CLower temperatures reduce inclusion body formation
    IPTG concentration0.1-0.5 mMGradual induction improves membrane protein folding
    Expression duration12-18 hoursExtended time at lower temperatures maximizes yield
    Media compositionTB or 2×YT with 5% glycerolProvides better membrane protein support
  • Membrane protein solubilization:

    • Primary solubilization: 1% n-dodecyl β-D-maltoside (DDM) in 20 mM Tris-HCl pH 7.4, 300 mM NaCl

    • Alternative detergents: LDAO, Triton X-100, or digitonin at experimentally determined CMCs

    • Inclusion of 10% glycerol and 5 mM ATP to stabilize protein conformation

  • Purification strategy:

    • Initial capture: Ni-NTA affinity chromatography for His-tagged constructs

    • Intermediate purification: Ion exchange chromatography using salt gradient elution

    • Polishing step: Size exclusion chromatography in detergent-containing buffer

    • Optional: On-column detergent exchange to more suitable detergents for downstream applications

  • Quality control assessments:

    • SDS-PAGE and Western blotting with anti-His and anti-atpI antibodies

    • Circular dichroism to confirm secondary structure integrity

    • Dynamic light scattering to assess homogeneity

    • Limited proteolysis to verify proper folding

The purification process should yield approximately 1-3 mg of purified protein per liter of bacterial culture, with purity >95% as assessed by SDS-PAGE and mass spectrometry .

How can researchers effectively measure the enzymatic activity of recombinant atpI in experimental systems?

Measuring enzymatic activity of recombinant atpI requires specialized techniques that account for its role within the larger ATP synthase complex:

  • Reconstitution approaches:

    • Liposome reconstitution using soybean phospholipids or synthetic lipid mixtures mimicking chloroplast membranes

    • Co-reconstitution with other ATP synthase subunits to form functional complexes

    • Generation of proteoliposomes with controlled orientation through freeze-thaw cycles

  • Proton translocation assays:

    • Monitoring of pH changes using ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching

    • Inside-out membrane vesicle preparation to measure proton pumping activity

    • Creation of artificial proton gradients using acid-base transitions or ionophores

  • ATP synthesis measurement systems:

    • Continuous luminescence monitoring using luciferine/luciferase similar to methods employed in wheat mitochondria studies

    • NADP+ reduction coupling assays with glucose-6-phosphate dehydrogenase

    • 32P-labeled ADP incorporation into ATP

  • Membrane potential monitoring:

    • Fluorescent dye-based methods using safranine or rhodamine derivatives

    • Patch-clamp electrophysiology for direct current measurements

    • Potentiometric indicators to track ΔΨ generation in real-time

  • Data analysis considerations:

    ParameterCalculation MethodTypical Range for Wheat atpI
    Specific activityμmol ATP/min/mg protein2-5 μmol/min/mg
    Km for ADPMichaelis-Menten kinetics100-300 μM
    Proton:ATP ratioThermodynamic analysis4.0-4.7 H+/ATP
    Activation energyArrhenius plot40-60 kJ/mol

The methodological approach should be adapted from established protocols for measuring ATP synthesis in wheat mitochondria, with appropriate modifications for chloroplastic systems. The luciferine/luciferase continuous monitoring system and safranine-based membrane potential measurements used in wheat mitochondria research can be particularly valuable starting points .

How should researchers interpret varying atpI activity data across different wheat cultivars when using recombinant proteins?

Interpreting variation in atpI activity across wheat cultivars requires careful consideration of multiple factors:

  • Genetic variation analysis:

    • Sequence alignment of atpI genes across cultivars to identify SNPs and insertion/deletion variations

    • Correlation of sequence variations with functional differences

    • Consideration of cultivar-specific post-transcriptional modifications, such as RNA editing patterns observed in mitochondrial atp1 genes (11 editing sites in drought-tolerant Giza168 versus 6 sites in drought-sensitive Gemmiza10)

  • Statistical approaches for comparative analysis:

    • ANOVA with post-hoc tests (Tukey's HSD) for multi-cultivar comparisons

    • Linear mixed-effects models to account for environmental factors

    • Principal component analysis to identify patterns in multivariate data sets

    • False discovery rate control for multiple hypothesis testing

  • Normalization strategies:

    • Activity normalization to protein content using Bradford or BCA assays

    • Consideration of chlorophyll content for chloroplastic proteins

    • Internal standards inclusion for cross-laboratory comparability

    • Baseline correction using non-functional mutants

  • Cultivar performance correlation:

    • Integration with agronomic performance data from field trials

    • Correlation with photosynthetic efficiency measurements

    • Consideration of abiotic stress tolerance rankings similar to the wheat variety performance rankings in the AgriLife Extension Wheat Grain "Picks" List

  • Visualization and reporting guidelines:

    Data TypeRecommended VisualizationStatistical Reporting
    Activity comparisonsBox plots with individual data pointsMean ± SD, p-values, effect sizes
    Kinetic parametersMichaelis-Menten or Lineweaver-Burk plotsKm, Vmax with 95% confidence intervals
    Cultivar correlationsHeat maps or network diagramsPearson/Spearman r values with significance
    Time-course dataLine graphs with error barsRepeated measures statistics

When analyzing recombinant protein activity data, researchers should consider that differences might reflect genetic adaptation to specific environmental conditions, similar to how drought-tolerant wheat cultivars showed distinct RNA editing patterns in mitochondrial atp1 .

What approaches can resolve contradictory findings regarding the impact of environmental stressors on chloroplastic ATP synthase function?

Resolving contradictory findings in environmental stress studies requires systematic methodological approaches:

  • Meta-analysis framework:

    • Systematic review of literature using PRISMA guidelines

    • Weighted effect size calculations across studies

    • Publication bias assessment using funnel plots

    • Subgroup analysis based on experimental conditions

  • Standardization protocols:

    • Development of reference materials for cross-laboratory calibration

    • Standardized stress application protocols similar to the controlled drought stress treatments used in mitochondrial atp1 studies

    • Consensus measurement techniques for ATP synthesis and membrane potential

    • Common data reporting formats to enable direct comparisons

  • Multi-factorial experimental designs:

    • Full factorial experiments examining interactions between stressors

    • Dose-response relationships across stress intensity gradients

    • Time-course analysis at standard intervals (control, 2-hour, 12-hour timepoints)

    • Consideration of recovery phases post-stress

  • Mechanistic resolution approaches:

    • Isolation of specific components (e.g., separating transcriptional vs. post-translational effects)

    • Site-directed mutagenesis to test hypothesized mechanisms

    • In vitro versus in vivo comparison studies

    • Bottom-up validation using reconstituted systems

  • Integration with systems biology:

    • Transcriptomic profiling to identify co-regulated genes

    • Metabolic flux analysis to contextualize ATP production changes

    • Network modeling to identify regulatory nodes

    • Multi-omics data integration for comprehensive perspective

When addressing contradictory findings, researchers should consider that stress responses may be cultivar-specific, as demonstrated by the differential RNA editing patterns observed between drought-tolerant and drought-sensitive wheat cultivars in response to water stress .

How can recombinant atpI be utilized to investigate the evolutionary adaptation of wheat photosynthesis to different environmental conditions?

Recombinant atpI offers powerful opportunities for evolutionary research:

  • Comparative genomics and protein engineering:

    • Sequence analysis across wild relatives and modern wheat varieties

    • Ancestral sequence reconstruction to trace evolutionary trajectories

    • Site-directed mutagenesis to recreate ancestral protein variants

    • Domain swapping experiments between cultivars with different stress adaptations

  • Functional evolution assays:

    • In vitro activity measurements of recombinant ancestral versus modern atpI proteins

    • Thermal stability comparisons across evolutionary variants

    • pH response profiles to detect adaptation to different soil conditions

    • Reconstitution with partner subunits from different evolutionary time points

  • Selection pressure analysis:

    • Calculation of Ka/Ks ratios to identify sites under positive selection

    • Structural mapping of selected residues onto protein models

    • Correlation with climatic data from regions of origin for different wheat landraces

    • Integration with performance data from variety trials similar to those conducted by AgriLife Extension

  • Experimental evolution approaches:

    • Directed evolution of atpI under controlled selection conditions

    • High-throughput screening for enhanced photosynthetic efficiency

    • Laboratory adaptation studies mimicking climate change scenarios

    • Transgenic complementation studies in model systems

  • Field-to-lab translational research:

    • Collection of atpI sequence data from diverse geographical wheat populations

    • Correlation with photosynthetic performance under field conditions

    • Climate-matching models to predict optimal atpI variants for specific environments

    • Assessment of adaptability indices similar to those used in evaluating wheat varieties for the "Picks" list

This evolutionary approach can leverage the knowledge gained from studying differential RNA editing patterns in wheat cultivars with varying stress tolerance, providing insights into molecular adaptation mechanisms at both genetic and post-transcriptional levels .

What emerging technologies are enhancing our understanding of chloroplastic ATP synthase function in wheat?

Cutting-edge technologies are revolutionizing ATP synthase research:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for near-atomic resolution of intact ATP synthase complexes

    • Single-particle analysis to capture conformational states during catalytic cycle

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

    • Integrative structural biology combining X-ray crystallography, NMR, and molecular dynamics

  • Single-molecule techniques:

    • Optical tweezers to measure rotational torque of ATP synthase

    • Magnetic tweezers for force-dependent kinetic measurements

    • FRET-based sensors for conformational change detection

    • High-speed AFM to visualize ATP synthase operation in real time

  • Genome editing and synthetic biology:

    • CRISPR-Cas9 editing of chloroplast genomes for precise atpI modifications

    • Minimal synthetic chloroplast ATP synthase construction

    • Orthogonal translation systems for unnatural amino acid incorporation

    • Optogenetic control of ATP synthase components

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM/PALM) for sub-diffraction visualization

    • Label-free imaging using stimulated Raman scattering

    • Correlative light and electron microscopy for structure-function studies

    • Functional imaging using genetically encoded ATP sensors

  • Light modulation approaches:

    • Adaptation of Helium-Neon laser techniques used in wheat mitochondria studies

    • Targeted photosensitizers for spatial control of ATP synthase activity

    • Light-driven artificial proton pumps to power ATP synthesis

    • Spectroscopic techniques for non-invasive monitoring of chloroplast energetics

These emerging technologies can build upon foundational research such as the light sensitivity of oxidative phosphorylation observed in wheat mitochondria, expanding our understanding of how energy conversion processes in plant organelles respond to environmental stimuli .

What are common pitfalls when working with recombinant chloroplastic atpI and how can researchers overcome them?

Common pitfalls and solutions:

  • Expression yield issues:

    • Problem: Poor expression in bacterial systems

    • Solution: Use specialized expression strains (C41/C43), lower induction temperature to 16°C, co-express molecular chaperones, or switch to cell-free wheat germ expression systems

  • Protein solubility challenges:

    • Problem: Formation of inclusion bodies

    • Solution: Optimize detergent screening protocol with at least 12 different detergents, include stabilizing additives (glycerol, ATP, specific lipids), or use mild solubilization strategies with sarkosyl followed by exchange to milder detergents

  • Activity loss during purification:

    • Problem: Purified protein shows minimal activity

    • Solution: Maintain strict temperature control (4°C throughout), include ATP and EDTA in all buffers, minimize purification steps, and validate activity at each stage

  • Reconstitution inefficiency:

    • Problem: Poor incorporation into liposomes

    • Solution: Optimize lipid composition to mimic chloroplast membranes, control protein:lipid ratios (1:100 to 1:50 w/w), and use controlled detergent removal via dialysis or Bio-Beads

  • Data inconsistency issues:

    IssueDiagnostic ApproachResolution Strategy
    Variable activity measurementsCV% calculation between replicatesStandardize assay conditions, include internal controls
    Protein degradationTime-course stability analysisAdd protease inhibitors, optimize storage conditions
    Contaminating ATPase activityHeat inactivation controlsImplement specific inhibitor panel for different ATPase types
    Non-specific bindingPull-down with control beadsAdd blocking agents, increase wash stringency
  • Orientation problems in proteoliposomes:

    • Problem: Random protein orientation affecting directional assays

    • Solution: Implement freeze-thaw cycles with ATP to bias orientation, use ionophores to collapse gradients for baseline measurements, or employ membrane-impermeable probes to distinguish inside-out vs. right-side-out vesicles

These troubleshooting approaches should be documented systematically, similar to the methodical documentation used in wheat variety performance trials, to ensure reproducibility and continuous improvement of protocols .

How can researchers validate that their recombinant atpI protein correctly represents native chloroplastic ATP synthase function?

Validation of recombinant atpI authenticity requires multiple complementary approaches:

  • Structural validation:

    • Circular dichroism spectroscopy to confirm secondary structure composition

    • Limited proteolysis patterns compared to native protein

    • Epitope recognition by conformation-specific antibodies

    • Thermal denaturation profiles matching native protein

  • Functional authentication:

    • Proton translocation efficiency compared to chloroplast membrane preparations

    • Reconstitution with other ATP synthase subunits to form functional complexes

    • Inhibitor sensitivity profiles matching native enzyme (oligomycin, venturicidin, etc.)

    • Kinetic parameters (Km, Vmax) comparison with literature values for native protein

  • Interaction verification:

    • Co-immunoprecipitation with partner subunits

    • Native gel electrophoresis to confirm complex formation

    • Surface plasmon resonance to quantify binding affinities

    • Cross-linking mass spectrometry to map interaction interfaces

  • In vivo complementation:

    • Genetic complementation assays in model systems

    • Rescue of atpI knockout phenotypes

    • Chloroplast transformation and replacement of native gene

    • Physiological measurements of photosynthetic parameters

  • Comparative analysis methods:

    • Side-by-side activity measurements with chloroplast membranes

    • Differential scanning calorimetry comparison

    • Hydrogen-deuterium exchange patterns

    • Post-translational modification analysis matching native protein

How can wheat ATP synthase research benefit from interdisciplinary collaboration with structural biologists, agricultural scientists and biophysicists?

Interdisciplinary collaboration creates powerful synergies in ATP synthase research:

  • Structural biology integration:

    • Cryo-EM specialists can resolve complete wheat chloroplast ATP synthase structures

    • X-ray crystallographers can determine high-resolution structures of individual domains

    • NMR spectroscopists can elucidate dynamic regions and conformational changes

    • Computational structural biologists can model subunit interactions and dynamics

  • Agricultural science partnerships:

    • Field researchers can provide diverse wheat germplasm for comparative studies

    • Crop physiologists can correlate ATP synthase variations with plant performance

    • Breeding programs can incorporate ATP synthase efficiency as a selection criterion

    • Variety trial networks like those conducted by AgriLife Extension can evaluate physiological impact across environments

  • Biophysics collaborations:

    • Single-molecule biophysicists can measure rotational dynamics of the ATP synthase

    • Membrane biophysicists can characterize lipid-protein interactions

    • Spectroscopists can develop non-invasive methods for monitoring ATP synthesis

    • Theoretical biophysicists can model energy transduction efficiency

  • Translational research frameworks:

    • Development of high-throughput screening methods for ATP synthase variants

    • Creation of synthetic biology platforms for optimizing chloroplast energy systems

    • Translation of basic findings into improved photosynthetic efficiency in crops

    • Integration with public-private partnerships similar to those supporting U.S. Wheat Associates

  • Collaborative infrastructure requirements:

    Resource TypeContribution to ATP Synthase ResearchCollaborative Access Model
    Advanced light sourcesStructural determinationShared facility access agreements
    Field trial networksPhysiological validationMulti-institution collaborative trials
    Computational clustersMolecular dynamics simulationsCloud-based resource sharing
    Mass spectrometry facilitiesProteomic analysisCore facility partnerships

Such interdisciplinary approaches enable comprehensive understanding from molecule to field, similar to how the wheat variety evaluation program integrates multiple assessment criteria across diverse environments to identify top-performing wheat varieties .

What standardized protocols would facilitate comparative studies of ATP synthase across different wheat varieties and growth conditions?

Standardized protocols are essential for meaningful cross-laboratory and cross-cultivar comparisons:

  • Plant growth standardization:

    • Defined growth medium composition with precise nutrient concentrations

    • Controlled environment chambers with standardized light intensity, photoperiod, temperature, and humidity

    • Developmental stage-specific sampling protocols (e.g., Zadoks scale for wheat)

    • Detailed metadata collection templates for growth conditions

  • Chloroplast isolation protocol:

    • Standardized tissue disruption methods (e.g., polytron settings, buffer compositions)

    • Percoll gradient purification with defined concentrations

    • Quality control criteria (chlorophyll a/b ratios, intactness assays)

    • Storage conditions and maximum storage times before analysis

  • ATP synthase activity measurement:

    • Reference materials for calibration across laboratories

    • Standardized assay conditions (pH, temperature, substrate concentrations)

    • Common detection systems (e.g., luciferine/luciferase as used in wheat mitochondria studies)

    • Data reporting templates with minimum required parameters

  • Stress application standardization:

    • Defined drought stress protocols with precise soil moisture monitoring

    • Heat stress application with controlled ramp rates and duration

    • Salt stress with standardized NaCl concentrations and application methods

    • Combinatorial stress protocols for realistic field condition simulation

  • Data integration framework:

    • Common database structure for depositing standardized results

    • Controlled vocabulary for experimental conditions

    • Statistical analysis pipelines for cross-study comparisons

    • Meta-analysis protocols for combining results across laboratories

This standardization approach would build upon the systematic methodology used in wheat variety trials and drought stress experiments, allowing researchers to integrate findings across studies and build a comprehensive understanding of ATP synthase biology in wheat .

What are the potential applications of engineered atpI variants for improving wheat photosynthetic efficiency and stress tolerance?

Engineered atpI variants offer promising opportunities for crop improvement:

  • Enhanced thermal stability engineering:

    • Identification of thermolabile regions through hydrogen-deuterium exchange

    • Introduction of stabilizing salt bridges at strategic positions

    • Incorporation of amino acids from thermophilic organisms

    • Computational design of stabilizing mutations verified through recombinant protein studies

  • Improved proton coupling efficiency:

    • Modification of proton channel residues to optimize conductance

    • Engineering of half-channel interfaces to reduce proton leakage

    • Optimization of the c-ring stoichiometry to improve H+/ATP ratio

    • Design of variants with reduced slippage under fluctuating conditions

  • Stress adaptation mechanisms:

    • Development of drought-responsive ATP synthase variants based on insights from differential RNA editing patterns in drought-tolerant wheat cultivars

    • Engineering salt-tolerant variants with modified ion interactions

    • Creation of cold-tolerant variants with altered lipid-protein interfaces

    • Design of oxidation-resistant variants for high light conditions

  • Photosynthetic optimization applications:

    • Integration with Rubisco engineering for coordinated improvement

    • Enhancement of ATP:NADPH ratio balancing for varying environmental conditions

    • Development of ATP synthase variants with reduced photoinhibition sensitivity

    • Engineering of variants with faster induction kinetics upon light exposure

  • Implementation approaches:

    StrategyTechnical ApproachTimelinePotential Impact
    Chloroplast transformationBiolistic delivery of engineered atpINear-termDirect replacement of native gene
    Nuclear transformationSynthetic atpI with chloroplast targetingMid-termPotential for tissue-specific control
    RNA editing modificationPPR protein engineering to alter editing patternsMid-termLeveraging natural variation mechanisms
    CRISPR base editingPrecise modification of specific codonsNear-termMinimal off-target effects

These approaches could build upon the observed differences in RNA editing patterns between drought-tolerant and drought-sensitive wheat cultivars, potentially offering novel strategies for engineering stress-tolerant crops with enhanced energy conversion efficiency .

How might advances in understanding chloroplastic ATP synthase contribute to synthetic biology applications in photosynthesis optimization?

Advances in ATP synthase research enable transformative synthetic biology applications:

  • Minimal photosynthetic systems:

    • Design of streamlined ATP synthase variants with reduced complexity

    • Integration with minimal electron transport chains

    • Development of simplified regulatory circuits for activity control

    • Creation of modular components for synthetic chloroplasts

  • Hybrid energy systems:

    • Engineering of chimeric ATP synthases incorporating features from diverse species

    • Development of artificial light-harvesting systems coupled to ATP production

    • Creation of synthetic metabolic pathways optimized for specific ATP:NADPH ratios

    • Integration with artificial photosynthetic systems for solar fuel production

  • Dynamic regulatory circuits:

    • Design of ATP synthase variants with engineered allosteric regulation

    • Development of synthetic circuits linking ATP production to metabolic demand

    • Creation of optogenetic control systems for ATP synthase activity

    • Engineering of biosensors for real-time monitoring and feedback control

  • Novel applications beyond native function:

    • Repurposing of ATP synthase as a nanomotor for synthetic applications

    • Development of ATP synthase-based biosensors for environmental monitoring

    • Creation of artificial proton gradient harvesters for energy generation

    • Engineering of ATP synthase-derived protein scaffolds for nanomaterial organization

  • Implementation considerations:

    • Standardized characterization methods for synthetic ATP synthase components

    • Development of modeling frameworks for predicting system behavior

    • Creation of high-throughput screening platforms for variant evaluation

    • Establishment of synthetic biology registries for ATP synthase parts and modules

These synthetic biology approaches could build upon insights from studies of light sensitivity in wheat mitochondrial ATP synthesis, potentially enabling the development of light-responsive synthetic energy systems with enhanced efficiency and control .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.