Recombinant Triticum aestivum ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Overview of ATP Synthase Subunit a (ATP6)

ATP6 is a mitochondrial-encoded subunit of the F₀ domain of ATP synthase (Complex V). It forms part of the proton channel critical for coupling proton translocation to ATP synthesis . In plants like Triticum aestivum (wheat), ATP6 is essential for oxidative phosphorylation (OXPHOS) in mitochondria.

Recombinant ATP6 Production

Recombinant ATP6 involves cloning and expressing the ATP6 gene in heterologous systems (e.g., E. coli or yeast). For example:

  • Expression System: E. coli is commonly used for cost-effective production .

  • Tagging: His-tags facilitate purification via affinity chromatography .

  • Sequence: The T. aestivum ATP6 (UniProt: C8CMP1) is a 58-amino acid protein with a molecular weight of ~6 kDa .

Table 1: Key Properties of Triticum aestivum ATP6

PropertyDetail
GeneMitochondrial ATP6
Protein Length58 amino acids
Molecular Weight~6 kDa
FunctionProton channel in F₀ domain
UniProt EntryC8CMP1 (unreviewed, TrEMBL)

Research Applications

While no studies on recombinant wheat ATP6 were identified, analogous work in other species suggests potential uses:

  • Structural Studies: Recombinant ATP6 could aid in resolving ATP synthase architecture .

  • Functional Assays: Testing proton translocation efficiency or oligomycin sensitivity .

  • Pathology Models: Mutations in human ATP6 cause mitochondrial diseases (e.g., Leigh syndrome) ; recombinant variants could help study plant OXPHOS defects.

Challenges and Knowledge Gaps

  • Sequence Variability: Plant ATP6 differs from mammalian homologs (e.g., human ATP6 has 226 residues vs. wheat’s 58) .

  • Assembly Dependencies: ATP6 requires interaction with subunits like ATP8 and the c-ring for stable integration into F₀ .

  • Lack of Direct Studies: No peer-reviewed publications specifically address recombinant wheat ATP6.

Future Directions

Proposed research areas include:

  1. Heterologous Co-expression: Co-express ATP6 with ATP8 or c-subunits to study assembly .

  2. Cryo-EM Studies: Resolve wheat ATP synthase structure using recombinant subunits.

  3. Agricultural Relevance: Investigate ATP6 mutations impacting wheat stress responses or yield.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Typically, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Triticum aestivum (Wheat)
Target Names
ATP6
Target Protein Sequence
MRFLSTDMKDRNMLFAAITTNQPIRSKCSRLPDLHDFFPTNISQNFAITPNLDITPTPER IAGVTIVLQIEEYLGQNESEQGAVNLARTVLGARHRNGETWQGILEDIRAGGGMDNFIQN LPGAYPETPLDQFAIIPIIDLHVGNFYLSFTNEVLYMLLTVVLVVFLFFVVTKKGGGKSV PNAWQSLVELIYDFVLNLVNEQIGGLSGNVKQKFFPRISVTFTFSLFRNPQGMIPFSFTV TSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRAL SLGIRLFANMMAGHSLVKILSGFAWTMLFLNNIFYFIGDLGPLFIVLALTGLELGVAISQ AHVSTISICIYLNDATNLHQNESFHN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) catalyzes the synthesis of ATP from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes within the respiratory chain. F-type ATPases consist of two distinct domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During ATP synthesis, the rotary mechanism of the central stalk subunits couples the catalytic activity of the F(1) domain to proton translocation. As a key component of the proton channel, subunit a likely plays a direct role in proton movement across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of ATP synthase subunit a (ATP6) in Triticum aestivum?

ATP synthase subunit a (ATP6) is a critical component of the Fo region of the mitochondrial ATP synthase complex (Complex V). In Triticum aestivum (wheat), this protein is encoded by the mitochondrial ATP6 gene and forms part of the proton channel within the inner mitochondrial membrane. The complete amino acid sequence consists of 386 amino acids, beginning with MRFLSTDMKD and ending with ATNLHQNESFHN .

Functionally, ATP6 plays a crucial role in the rotary mechanism of ATP synthesis. It works in conjunction with the c-ring to facilitate proton translocation across the inner mitochondrial membrane, which drives the rotational motion necessary for ATP production. The protons pass through subunit a to the c-ring, generating the energy required for the conformational changes in the F1 sector that ultimately result in ATP synthesis .

In terms of structure-function relationship, the subunit a acts as a stationary component (part of the "stator") relative to the rotating c-ring (part of the "rotor") during catalysis. This arrangement is essential for maintaining the proton gradient that powers ATP production .

How does ATP6 integrate within the larger ATP synthase complex in wheat mitochondria?

ATP6 integrates into the Fo domain of the ATP synthase complex, which is embedded in the inner mitochondrial membrane. The complete ATP synthase consists of two main functional domains: F1 (situated in the mitochondrial matrix) and Fo (located in the inner mitochondrial membrane). The ATP synthase subunit a (ATP6) is a key structural element of the Fo portion .

Integration of ATP6 occurs during the final stages of ATP synthase assembly. According to current assembly models, the c-ring forms first, followed by binding of the F1 sector and the peripheral stalk. ATP6 and A6L (another mitochondrially-encoded subunit) are added during the final steps of assembly . This sequential assembly process ensures proper formation of the functional complex and is crucial for maintaining mitochondrial bioenergetics.

What are the key physical and biochemical properties of recombinant Triticum aestivum ATP6?

The recombinant Triticum aestivum ATP6 protein has several important physical and biochemical characteristics that researchers should consider:

PropertySpecificationNotes
Molecular Weight25-30 kDa (observed)The calculated molecular weight is approximately 25 kDa
Amino Acid Length386 amino acidsFull-length protein
Storage Conditions-20°C to -80°CFor extended storage, use -80°C; avoid repeated freeze-thaw cycles
Working Storage4°CStable for up to one week
Buffer CompositionTris-based buffer with 50% glycerolOptimized specifically for this protein
Protein StabilityTemperature-sensitiveStore working aliquots appropriately to maintain activity
Associated ComponentsFunctions with other ATP synthase subunitsPart of a multi-subunit complex
Subcellular LocalizationInner mitochondrial membraneWithin the Fo portion of ATP synthase

For experimental work, it's crucial to maintain appropriate storage conditions. The recombinant protein is typically supplied in a Tris-based buffer with 50% glycerol, which helps maintain stability. When working with the protein, researchers should create working aliquots stored at 4°C (usable for up to one week) to avoid repeated freezing and thawing, which can compromise protein integrity .

What are the optimal conditions for handling and storing recombinant Triticum aestivum ATP6 in a laboratory setting?

Proper handling and storage of recombinant Triticum aestivum ATP6 is crucial for maintaining protein integrity and experimental reproducibility. Based on manufacturer specifications and research protocols, the following conditions are recommended:

Storage Temperature Hierarchy:

  • Long-term storage: -80°C (preferred) or -20°C

  • Medium-term storage: -20°C (stable for approximately one year after production)

  • Working aliquots: 4°C (stable for up to one week)

Buffer Considerations:
The recombinant protein is typically supplied in a Tris-based buffer containing 50% glycerol and may include pH stabilizers (usually at pH 7.3). This formulation protects the protein from degradation during freeze-thaw cycles .

Handling Recommendations:

  • Minimize freeze-thaw cycles by preparing appropriate working aliquots

  • When thawing, maintain the protein on ice to prevent denaturation

  • Centrifuge the vial briefly before opening to collect all material at the bottom

  • For experimental work, dilute in appropriate buffers immediately before use

  • Avoid exposure to strong reducing agents unless specifically required for your experimental design

Experimental Considerations:
For functional studies, it's important to note that ATP6 naturally functions as part of a complex. Isolated ATP6 may require specific conditions to maintain native conformation when used in in vitro experiments .

What western blotting protocols are most effective for detecting Triticum aestivum ATP6 in experimental samples?

Western blotting is a common technique for detecting and quantifying ATP6 in experimental samples. Based on validated protocols, the following approach is recommended:

Sample Preparation:

  • Extract total protein from mitochondrial fractions using a buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1% Triton X-100, and protease inhibitors

  • Heat samples at 70°C for 10 minutes (rather than 95°C) to prevent aggregation of membrane proteins

  • Load 20-30 μg of total protein per lane for clear detection

Electrophoresis and Transfer Conditions:

  • Use a 12-15% SDS-PAGE gel for optimal separation

  • Transfer to PVDF membrane (preferred over nitrocellulose for hydrophobic membrane proteins)

  • Use a wet transfer system at 30V overnight at 4°C for more complete transfer of membrane proteins

Immunodetection Protocol:

  • Block membrane with 5% non-fat dry milk in TBST for 1 hour at room temperature

  • Incubate with primary ATP6 antibody at dilutions of 1:500-1:1000 in blocking buffer overnight at 4°C

  • Wash 3x with TBST for 10 minutes each

  • Incubate with HRP-conjugated secondary antibody (typically 1:5000 dilution) for 1 hour at room temperature

  • Wash 3x with TBST for 10 minutes each

  • Develop using standard ECL detection methods

Expected Results:
The observed molecular weight for ATP6 is typically between 25-30 kDa. Positive controls should include mouse brain tissue, C2C12 cells, or rat brain samples, which have been validated for cross-reactivity with the antibody .

Troubleshooting:

  • If signal is weak, consider extending primary antibody incubation time or increasing concentration

  • If background is high, increase washing times and consider using a different blocking agent (BSA instead of milk)

  • For mitochondrial membrane proteins, gentle denaturation conditions often yield better results

What approaches can be used to study the interaction between ATP6 and other subunits of the ATP synthase complex?

Studying protein-protein interactions within the ATP synthase complex requires specialized techniques due to the complexity of membrane protein assemblies. Several complementary approaches can be employed:

Co-Immunoprecipitation (Co-IP):

  • Solubilize mitochondrial membranes using mild detergents (digitonin or DDM at 1-2%)

  • Perform immunoprecipitation using antibodies against ATP6

  • Analyze co-precipitated proteins by western blotting or mass spectrometry

  • Cross-linking prior to solubilization can capture transient interactions

Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

  • Solubilize mitochondrial membranes with digitonin (4-6 g/g protein)

  • Separate native complexes on 3-12% gradient gels

  • Perform second-dimension SDS-PAGE for subunit analysis

  • This approach allows visualization of intact ATP synthase complexes and subcomplexes (550 kDa for the complete complex)

Proximity Labeling Techniques:

  • Express ATP6 fused to a proximity labeling enzyme (BioID or APEX2)

  • Allow in vivo biotinylation of proximal proteins

  • Purify biotinylated proteins and identify by mass spectrometry

  • This approach captures both stable and transient interactions in their native environment

Cryo-Electron Microscopy:

  • Purify ATP synthase complexes using affinity chromatography

  • Subject to cryo-EM imaging and structural determination

  • This technique provides high-resolution structural information about subunit arrangements

Functional Complementation Assays:

  • Use yeast models with mutations in ATP6

  • Complement with wheat ATP6 variants

  • Assess restoration of ATP synthase function

  • This approach connects structural interactions with functional outcomes

These methods can be used in combination to develop a comprehensive understanding of ATP6 interactions within the complex architecture of ATP synthase.

How can recombinant Triticum aestivum ATP6 be used to study mitochondrial bioenergetics in wheat?

Recombinant Triticum aestivum ATP6 provides a valuable tool for investigating mitochondrial bioenergetics in wheat through several advanced experimental approaches:

Reconstitution Studies:
Recombinant ATP6 can be incorporated into liposomes or nanodiscs along with other ATP synthase components to recreate functional units. This system allows measurement of proton pumping activity and ATP synthesis rates under controlled conditions. By comparing wild-type ATP6 with engineered variants, researchers can assess the impact of specific residues on proton translocation efficiency and coupling with ATP synthesis .

Structure-Function Analysis:
The availability of recombinant ATP6 enables site-directed mutagenesis studies targeting specific amino acid residues predicted to be involved in proton channeling or subunit interactions. Mutant proteins can be assessed for their ability to integrate into the ATP synthase complex and support ATP synthesis, providing insights into the molecular mechanisms of energy conversion .

Inhibitor Binding Studies:
Recombinant ATP6 can be used to study the binding characteristics of known ATP synthase inhibitors (such as oligomycin) that target the Fo region. Such studies can help identify inhibitor binding sites and develop wheat-specific inhibitors for research purposes, which may also inform the development of novel fungicides that target pathogen ATP synthases while sparing the host enzyme.

Investigation of Stress Responses:
By comparing the post-translational modifications of native ATP6 isolated from wheat grown under various stress conditions with the recombinant protein, researchers can identify stress-induced modifications that may regulate ATP synthase activity. This approach can help elucidate how wheat adapts its energy metabolism to environmental challenges like drought, salt stress, or pathogen attack .

In Vitro RNA Editing Studies:
The availability of recombinant ATP6 allows investigation of mitochondrial RNA editing mechanisms, which have been observed in wheat ATP synthase components. By comparing protein products from edited and unedited transcripts, researchers can assess the functional significance of RNA editing in regulating ATP synthase activity and assembly .

What role does ATP6 play in wheat mitochondrial ATP synthase assembly, and how can this be experimentally investigated?

ATP6 plays a critical role in the assembly and stability of the mitochondrial ATP synthase complex in wheat. Understanding this process is essential for comprehending mitochondrial bioenergetics and can be investigated through several experimental approaches:

Assembly Pathway Characterization:
Research indicates that ATP6 is incorporated during the final stages of ATP synthase assembly. This suggests that the assembly pathway in wheat, similar to other organisms, involves the initial formation of the c-ring, followed by binding of the F1 sector and peripheral stalk, and finally the incorporation of ATP6 and A6L subunits. This model can be tested experimentally by pulse-chase experiments with radiolabeled amino acids combined with immunoprecipitation to track the temporal sequence of subunit incorporation into the complex .

Assembly Intermediate Analysis:
Blue Native PAGE (BN-PAGE) can be used to separate and identify assembly intermediates. By analyzing mitochondrial extracts from wheat tissues at different developmental stages or under various stress conditions, researchers can visualize distinct subcomplexes. Subsequent immunoblotting with anti-ATP6 antibodies can reveal which intermediates contain ATP6, helping to map its entry point in the assembly process .

Study of Assembly Factors:
Several assembly factors have been identified that specifically facilitate the incorporation of ATP6 into the ATP synthase complex. For example, ATP12 and TMEM70 are known assembly factors in other systems. Homologs of these factors can be identified in wheat and their interactions with ATP6 can be studied using co-immunoprecipitation, yeast two-hybrid assays, or proximity labeling techniques .

Impact of ATP6 Mutations:
The effect of ATP6 mutations on complex assembly can be studied using in vitro import assays, where radiolabeled mutant and wild-type ATP6 proteins are imported into isolated wheat mitochondria. Subsequent BN-PAGE analysis can reveal differences in the efficiency of incorporation into the complex, helping to identify regions of ATP6 that are crucial for assembly .

Coordination with Nuclear-Encoded Subunits:
The assembly of ATP synthase requires coordination between mitochondrially-encoded subunits (like ATP6) and nuclear-encoded components. This coordination can be studied by analyzing changes in ATP6 expression and complex assembly in response to signals that alter nuclear gene expression, such as retrograde signaling pathways activated during mitochondrial stress .

How does RNA editing affect ATP6 function in wheat mitochondria, and what methods can be used to study this phenomenon?

RNA editing is a post-transcriptional process that can alter the coding sequence of mitochondrial transcripts, including those encoding ATP synthase components in wheat. This process can have significant implications for protein function and mitochondrial bioenergetics:

RNA Editing in Wheat ATP6:
Recent studies have identified RNA editing events in mitochondrial transcripts from wheat, including those related to ATP synthase components. These editing events can change the amino acid sequence of the resulting protein, potentially affecting its function, stability, or interactions within the complex. Notably, RNA editing patterns may be altered under stress conditions, suggesting a regulatory role in adaptation to environmental challenges .

Experimental Approaches to Study RNA Editing:

MethodProtocol OutlineApplication
RT-PCR and Sequencing1. Extract total RNA from wheat mitochondria
2. Generate cDNA using reverse transcription
3. Amplify ATP6 transcripts
4. Sequence amplicons and compare to genomic sequence
Identifies specific editing sites within ATP6 transcripts
RNA-Seq Analysis1. Prepare mitochondrial RNA libraries
2. Perform deep sequencing
3. Map reads to reference sequences
4. Identify mismatches between RNA and DNA
Comprehensive identification of all editing sites in mitochondrial transcripts
Protein Mass Spectrometry1. Isolate mitochondrial proteins
2. Perform tryptic digestion
3. Analyze peptides by MS/MS
4. Compare detected peptides with predicted sequences
Confirms that editing events result in amino acid changes at the protein level
In Vitro Editing Assays1. Prepare mitochondrial extracts containing editing machinery
2. Incubate with synthetic ATP6 RNA substrates
3. Analyze editing efficiency by primer extension or sequencing
Identifies factors required for ATP6 transcript editing
CRISPR-Based Approaches1. Design guide RNAs targeting editing factors
2. Generate wheat lines with altered editing capability
3. Analyze effects on ATP6 transcript editing and function
Establishes the physiological significance of specific editing events

Functional Consequences of RNA Editing:
The functional impact of RNA editing can be assessed by comparing the properties of recombinant ATP6 proteins derived from edited versus unedited transcripts. Key parameters to evaluate include:

  • Complex assembly efficiency

  • ATP synthesis rates

  • Proton translocation activity

  • Thermal stability

  • Interaction with other subunits

Research has shown that RNA editing in plant mitochondrial transcripts often restores conserved amino acids that are critical for protein function, suggesting that editing is an essential process for maintaining mitochondrial activity. Additionally, editing patterns may be altered in response to stress conditions, potentially representing a mechanism for rapidly adjusting mitochondrial function without requiring changes in gene expression .

What are common challenges when working with recombinant ATP6, and how can these be addressed?

Working with recombinant ATP6 presents several technical challenges due to its hydrophobic nature and membrane protein characteristics. Researchers should be aware of these issues and implement appropriate strategies to overcome them:

Problem: Protein Aggregation and Precipitation

  • Causes: Hydrophobic nature of membrane proteins, improper buffer conditions, concentration too high

  • Solutions:

    • Use buffers containing mild detergents (0.1% DDM or 0.5% CHAPS)

    • Add glycerol (10-20%) to enhance stability

    • Maintain protein at moderate concentrations (<1 mg/ml)

    • Avoid excessive vortexing or harsh mixing

Problem: Low Yield in Expression Systems

  • Causes: Toxicity to host cells, improper codon usage, protein misfolding

  • Solutions:

    • Use specialized expression systems designed for membrane proteins

    • Optimize codon usage for the expression host

    • Express as a fusion with solubility-enhancing tags (MBP, SUMO)

    • Use lower induction temperatures (16-18°C) to slow production rate

Problem: Difficulty in Detecting Activity

  • Causes: ATP6 functions as part of a complex, not individually

  • Solutions:

    • Reconstitute with other ATP synthase components

    • Use indirect assays that measure interaction with partner proteins

    • Incorporate into liposomes to create a membrane environment

Problem: Non-specific Antibody Binding in Immunodetection

  • Causes: Cross-reactivity with other ATP synthase subunits, non-specific binding

  • Solutions:

    • Use validated antibodies with confirmed specificity

    • Increase washing steps and duration

    • Optimize blocking conditions (5% BSA often works better than milk for membrane proteins)

    • Include appropriate negative controls

Problem: Variable Results in Functional Assays

  • Causes: Post-translational modifications, partial denaturation

  • Solutions:

    • Standardize protein preparation protocols

    • Perform quality control checks before experiments

    • Include positive controls in all assays

    • Consider batch effects when analyzing data

How can researchers verify the structural integrity and functional activity of recombinant Triticum aestivum ATP6?

Ensuring the quality of recombinant ATP6 is crucial for obtaining reliable experimental results. The following quality control measures can be implemented:

Structural Integrity Assessment:

  • SDS-PAGE Analysis:

    • Run protein on 12-15% gels under reducing conditions

    • Look for a single band at the expected molecular weight (25-30 kDa)

    • Absence of degradation products or aggregates indicates good integrity

  • Circular Dichroism (CD) Spectroscopy:

    • Analyze secondary structure content

    • ATP6 should show characteristic spectra of alpha-helical membrane proteins

    • Compare with reference spectra from well-characterized membrane proteins

  • Limited Proteolysis:

    • Treat protein with controlled amounts of proteases

    • Correctly folded membrane proteins often show resistance to digestion in detergent-protected regions

    • Compare digestion pattern with native protein from wheat mitochondria

  • Thermal Stability Assays:

    • Monitor protein unfolding using differential scanning fluorimetry

    • Properly folded ATP6 should show cooperative unfolding behavior

    • Stability curves can serve as reference for future protein preparations

Functional Activity Verification:

  • Binding Assays with Partner Proteins:

    • Test interaction with other ATP synthase subunits using pull-down assays

    • Positive binding indicates properly folded interaction surfaces

  • Reconstitution into Proteoliposomes:

    • Incorporate ATP6 with other Fo components into liposomes

    • Measure proton translocation using pH-sensitive fluorescent dyes

    • Functional protein should facilitate proton movement across the membrane

  • Inhibitor Binding Studies:

    • Test binding of known ATP synthase inhibitors (e.g., oligomycin)

    • Specific binding indicates preservation of native structure

  • Mass Spectrometry Analysis:

    • Verify full-length protein and correct sequence

    • Identify any post-translational modifications

    • Confirm absence of chemical modifications that might affect function

By implementing these quality control measures, researchers can ensure that their recombinant ATP6 preparations maintain structural integrity and functional capacity, leading to more reliable and reproducible experimental results.

What are the current research frontiers involving ATP6 in wheat and other cereal crops?

Research on ATP6 in wheat and other cereal crops is advancing rapidly, with several exciting frontiers emerging:

RNA Editing and Post-transcriptional Regulation:
Recent studies have revealed complex patterns of RNA editing in wheat mitochondrial transcripts, including those encoding ATP synthase components. This editing appears to be responsive to environmental conditions, suggesting a role in adaptive responses. Understanding the mechanisms and consequences of ATP6 transcript editing represents a significant research frontier. Researchers are investigating how editing affects protein function and how editing patterns change under stress conditions like drought .

Role in Stress Responses:
ATP6 and ATP synthase function appear to be modulated during various stress responses in cereals. Current research is investigating:

  • Changes in ATP synthase activity during drought stress

  • Modifications to ATP6 structure and function during heat stress

  • Alterations in complex assembly during oxidative stress

  • The relationship between ATP synthase function and programmed cell death pathways

Genetic Diversity and Crop Improvement:
Studies are underway to characterize natural variation in ATP6 sequences across wheat varieties and related wild species. This research aims to identify variants with improved energy efficiency or stress tolerance that could be incorporated into breeding programs. The potential connection between mitochondrial function and agronomic traits like yield stability under stress is a particularly active area of investigation.

Structural Biology Approaches:
Advances in cryo-electron microscopy are enabling higher-resolution structural studies of plant ATP synthases, including the arrangement and interactions of ATP6 within the complex. These structural insights are informing functional studies and providing targets for rational design of variants with altered properties.

How does ATP6 function compare between wheat and other species, and what are the implications for research methodology?

Comparative analysis of ATP6 across species reveals important similarities and differences that influence research approaches:

Sequence Conservation and Divergence:

SpeciesSequence Identity with Wheat ATP6Key DifferencesMethodological Implications
Rice (Oryza sativa)~80-85%Minor differences in transmembrane domainsMethods can generally be transferred between cereals
Arabidopsis (A. thaliana)~60-65%Differences in proton channel residuesSome antibodies may not cross-react; functional assays may need adjustment
Yeast (S. cerevisiae)~40-45%Significant differences in interaction domainsYeast models require careful validation; complementation may be challenging
Human~30-35%Major differences in regulatory regionsHuman ATP6 inhibitors may not affect wheat ATP6; different assembly factors
Bacterial homologs~20-25%Simplified subunit compositionBacterial models provide basic mechanistic insights but lack plant-specific features

Genetic Manipulation Approaches:
The mitochondrial location of the ATP6 gene poses challenges for genetic manipulation. While CRISPR-based approaches have been developed for nuclear genes in wheat, mitochondrial genome editing remains difficult. Alternative approaches include:

  • Using RNA interference to reduce expression

  • Expressing modified versions from the nuclear genome with mitochondrial targeting

  • Using natural variants identified in germplasm collections

  • Studying the effects of altered nuclear factors that regulate ATP6 function

Experimental System Selection:
When studying wheat ATP6, researchers must choose appropriate experimental systems:

  • In vitro biochemical studies with recombinant protein

  • Isolated wheat mitochondria for functional assays

  • Heterologous expression in yeast (with careful validation)

  • Wheat cell cultures for cellular studies

  • Whole plant systems for physiological relevance

What are the implications of ATP6 research for understanding mitochondrial diseases in plants and potential applications in crop improvement?

Research on ATP6 has significant implications for both fundamental understanding of plant mitochondrial diseases and practical applications in crop improvement:

Mitochondrial Diseases in Plants:
Unlike in humans, where mitochondrial diseases often manifest as severe neurological or muscular disorders, plant mitochondrial dysfunction typically results in cytoplasmic male sterility (CMS), reduced vigor, or altered stress responses. ATP6 mutations have been implicated in several plant mitochondrial dysfunction phenotypes. Understanding the molecular basis of these disorders can provide insights into fundamental aspects of plant mitochondrial biology and crop performance.

Key insights from ATP6 research include:

  • The role of proper ATP synthase assembly in maintaining mitochondrial membrane potential

  • Connections between energy production efficiency and growth rate

  • Relationship between mitochondrial function and reproductive development

  • Mechanisms of retrograde signaling from impaired mitochondria to the nucleus

Applications in Crop Improvement:

Future research directions should focus on integrating ATP6 studies with broader understanding of mitochondrial-nuclear interactions, whole-plant energy metabolism, and the relationship between mitochondrial function and agronomically important traits in wheat and other cereal crops.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.