Recombinant Triticum aestivum Chlorophyll a-b binding protein, chloroplastic (WHAB1.6)

Shipped with Ice Packs
In Stock

Description

Introduction

Chlorophyll a-b binding proteins (CABs) are essential components of the light-harvesting complex (LHC) in plants . The LHC functions as a light receptor, capturing and delivering excitation energy to photosystems . In Triticum aestivum (wheat), these proteins play a crucial role in photosynthesis by binding chlorophyll a and b, the pigments responsible for absorbing light energy . Recombinant WHAB1.6 refers to a specific CAB protein produced through recombinant DNA technology, derived from Triticum aestivum, and localized in the chloroplast .

Function and Structure

CAB proteins, including WHAB1.6, are vital for the efficient harvesting of light energy and its transfer to photosynthetic reaction centers . These proteins are integral membrane proteins located in the thylakoid membranes of chloroplasts, where they form complexes that capture photons and transfer energy to photosystems I and II .

Key aspects of CAB proteins:

  • Light Harvesting: CABs bind chlorophyll molecules and carotenoids, capturing a broad spectrum of light energy .

  • Energy Transfer: They efficiently transfer excitation energy to the reaction centers of photosystems, enhancing photosynthetic efficiency .

  • Structural Support: CABs stabilize the structure of the LHC and facilitate its interaction with other components of the photosynthetic machinery .

Molecular Cloning and Characterization

The study of CAB proteins often involves cloning and characterization at the molecular level. For instance, researchers have cloned and characterized CAB genes in tea plants (Camellia sinensis) to understand their function and regulation under stress conditions . These studies reveal that CAB genes encode proteins belonging to the external or internal antenna proteins of photosystem II (PSII) .

Important findings from such studies:

  • Gene Structure: CAB genes contain multiple functional domains and modifiable sites, making them targets for physiological regulation .

  • Expression Patterns: The expression of CAB genes can be influenced by various environmental stresses, suggesting their involvement in stress response .

  • Protein Structure: CAB proteins typically contain a CAB domain responsible for chlorophyll binding and may also contain other domains involved in protein-protein interactions and regulation .

Stress Response and Regulation

CAB proteins are known to be involved in the response of plants to various environmental stresses . The regulation of CAB protein levels allows chloroplasts to respond flexibly and rapidly to these stresses .

Mechanisms of regulation:

  • Genetic Level: Regulation at the genetic level has a lasting effect, although it may be a delayed response .

  • Protein Level: Cells can regulate CAB activity at many levels, such as gene and protein levels . Structural analysis shows that some CAB proteins contain domains that can be used as targets for physiological regulation in the PS II of plant cells and are affected by a variety of regulatory proteins .

Chlorophyll Binding

A typical CAB domain includes binding sites for chlorophyll a and b, as well as other molecules like 1,2-dipalmitoyl-phosphatidyl-glycerol . The precise amino acid sequence and structural conformation of the CAB domain determine its binding affinity and specificity for chlorophyll molecules .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request and incurs additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
WHAB1.6; Chlorophyll a-b binding protein, chloroplastic; LHCII type I CAB; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-266
Protein Length
Full Length of Mature Protein
Species
Triticum aestivum (Wheat)
Target Names
WHAB1.6
Target Protein Sequence
RKTAAKAKQVSSSSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAGWFKAGSQIFSDGGLDYLGNPSLVH AQSLLAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLAERPQAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLEDLADHIADPVNNNAWLIATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the primary functions of WHAB1.6 in wheat?

WHAB1.6 serves multiple crucial functions in wheat physiology:

  • Light energy capture: It binds chlorophyll molecules (both a and b types) to capture light energy during photosynthesis .

  • Energy transfer: After capturing light energy, it facilitates the transfer of this energy to photosynthetic reaction centers .

  • Photosynthetic enhancement: Research has demonstrated that WHAB1.6 can increase total chlorophyll and carotenoid content by approximately 1.3% and 2.9% respectively, and increase the net photosynthetic rate by 18% .

  • Stress response: It plays roles in both biotic and abiotic stress responses, although its expression is typically down-regulated under multiple stress conditions .

The dual roles of WHAB1.6 in both photosynthesis enhancement and stress response make it a protein of significant interest for agricultural research aimed at improving crop productivity and resilience.

How is WHAB1.6 expression regulated in wheat tissues?

WHAB1.6 expression shows specific patterns that vary by tissue type and environmental conditions:

  • Tissue specificity: It is highly expressed in green tissues, consistent with its role in photosynthesis .

  • Light responsiveness: The gene contains light-responsive cis-elements, indicating regulation by light conditions .

  • Stress response regulation: Expression is down-regulated by multiple stresses, including:

    • Drought stress

    • Salt stress

    • Pathogen infection

This down-regulation under stress is noteworthy because, counterintuitively, WHAB1.6 actually enhances ROS (reactive oxygen species) accumulation under drought and salt stresses. This suggests that the plant may decrease WHAB1.6 expression as a protective mechanism when faced with environmental challenges .

What methods are commonly used to study WHAB1.6 expression?

Several methodological approaches are employed to investigate WHAB1.6 expression:

  • RT-qPCR (Real-Time Quantitative PCR): Used to quantify mRNA expression levels of WHAB1.6 under different conditions. This technique has been employed to demonstrate that WHAB1.6 is down-regulated by drought and salt stresses .

  • RNA-Seq: Used for transcriptome-wide expression analysis, allowing researchers to compare WHAB1.6 expression with other genes. The FPKM (Fragments Per Kilobase of transcript per Million mapped reads) values obtained from RNA-Seq can be validated with RT-qPCR results .

  • Western Blot: Used to detect WHAB1.6 protein levels using specific antibodies. For example, anti-Lhca1 antibodies can cross-react with WHAB1.6 and can be used to detect the protein in plant samples .

  • Immunodetection: Used to visualize the protein in different plant tissues or under different conditions. Samples are typically loaded based on equal amounts of chlorophyll (e.g., 0.25 μg) for comparative analysis .

How does WHAB1.6 function in both photosynthesis and stress response pathways?

The dual role of WHAB1.6 in photosynthesis enhancement and stress susceptibility presents an interesting scientific paradox. Current research suggests the following mechanisms:

  • Photosynthesis enhancement:

    • WHAB1.6 increases total chlorophyll content by 1.3% and carotenoid content by 2.9%

    • It improves net photosynthetic rate (Pn) by 18%

    • These improvements likely result from optimized light capture and energy transfer to photosystems

  • Stress response pathway:

    • Despite being down-regulated during stress, when artificially maintained at higher levels, WHAB1.6:

      • Enhances ROS accumulation under drought and salt stresses

      • Promotes colonization by hemi-biotrophic pathogens

      • Strengthens BAX-induced cell death

      • Up-regulates pathogenesis-related genes

This apparent contradiction can be explained by the concept of a "susceptibility gene" - WHAB1.6 functions positively for photosynthesis under normal conditions but can exacerbate stress effects when highly expressed during stress conditions. The plant appears to have evolved regulatory mechanisms to down-regulate this protein during stress as a protective measure .

Research methodologies to study this dual function typically include:

  • Transgenic approaches (overexpression or knockdown of WHAB1.6)

  • ROS detection assays (e.g., NBT staining)

  • Chlorophyll fluorescence measurements

  • Pathogen infection assays

  • Gene expression analysis of stress-related genes in WHAB1.6-modified plants

What experimental approaches are most effective for analyzing WHAB1.6 interactions with other proteins?

Understanding WHAB1.6's protein-protein interactions is crucial for elucidating its complete functional network. The following methodologies have proven most effective:

  • Co-immunoprecipitation (Co-IP):

    • Utilizes anti-WHAB1.6 antibodies to pull down the protein complex

    • Coupled with mass spectrometry to identify interaction partners

    • Requires careful buffer optimization to maintain chloroplast protein interactions

  • Yeast two-hybrid (Y2H) assays:

    • Can screen for direct protein interactions

    • Requires proper design of bait constructs that exclude transmembrane domains

    • May yield false positives/negatives due to the chloroplast localization of native interactions

  • Bimolecular Fluorescence Complementation (BiFC):

    • Allows visualization of protein interactions in planta

    • Particularly useful for confirming interactions identified by other methods

    • Provides spatial information about where in the chloroplast interactions occur

  • Weighted Gene Co-expression Network Analysis (WGCNA):

    • Computational approach using transcriptome data

    • Identifies genes with similar expression patterns to WHAB1.6

    • Has been successfully applied in studies examining stress responses in wheat

A comparison of these methods based on published research is presented in Table 1:

MethodAdvantagesLimitationsBest Application Scenario
Co-IPDetects native complexesRequires specific antibodiesIdentifying components of LHCII complexes
Y2HHigh-throughput screeningHigh false positive rateInitial screening for potential interactors
BiFCIn vivo visualizationPotential artifacts from overexpressionConfirming interactions in plant cells
WGCNAGenome-wide perspectiveCorrelative rather than direct evidenceIdentifying co-regulated genes during stress

How can apparent contradictions in published WHAB1.6 research findings be reconciled?

Research on WHAB1.6 has sometimes yielded seemingly contradictory results, particularly regarding its role in stress responses. These contradictions can be systematically analyzed and potentially reconciled by considering several context-dependent factors:

  • Internal factors (species/variety differences):

    • Different wheat varieties may show varying WHAB1.6 responses

    • For example, drought-sensitive varieties (e.g., Zhoumai 28) show different expression patterns compared to drought-tolerant varieties (e.g., Luohan 22)

    • Context analysis should always specify the exact wheat variety used

  • External experimental conditions:

    • Light intensity and quality significantly affect WHAB1.6 function

    • Temperature variations during experiments can alter expression patterns

    • Dosage and duration of stress treatments yield different responses

    • Growth chamber conditions (16h light/8h dark cycle, 20/18°C day/night temperatures, 70% relative humidity) should be standardized

  • Temporal context:

    • Early vs. late responses to stress show different patterns

    • Developmental stage of the plant affects WHAB1.6 expression

    • Recovery periods after stress show unique expression profiles compared to during stress

  • Methodological approach:

    • Transcript vs. protein level analyses may yield different results

    • In vitro vs. in vivo studies can show contradictory findings

    • Overexpression vs. knockout studies provide complementary but sometimes seemingly contradictory information

When analyzing contradictory findings, researchers should construct a context matrix that maps each result to specific experimental conditions. This approach, similar to that described for biomedical literature analysis , can help identify patterns that explain apparent contradictions.

What are the latest techniques for studying WHAB1.6's role in ROS accumulation during stress?

Recent advances in methodology have enhanced our ability to study WHAB1.6's role in ROS production and stress responses:

  • ROS detection and quantification:

    • H₂O₂ content measurement: Extracted from leaf homogenate in trichloroacetic acid (TCA), then quantified spectrophotometrically at 390 nm using a KI-based reagent solution

    • Superoxide detection: Using nitro blue tetrazolium (NBT) assays that produce a purple formaldehyde product measured at 560 nm

    • In situ ROS visualization: Using fluorescent probes such as H₂DCFDA for live-cell imaging

  • Enzyme activity assays for antioxidant systems:

    • Peroxidase (POD) activity: Measured by monitoring absorbance changes at 436 nm using guaiacol as a substrate

    • Catalase (CAT) activity: Assessed by monitoring H₂O₂ decomposition rate at defined assay conditions

  • Integrated transcriptome and metabolome analysis:

    • RNA-Seq paired with metabolite profiling to correlate WHAB1.6 expression with metabolic changes during stress

    • WGCNA to identify gene modules correlated with WHAB1.6 expression

  • Controlled stress application protocols:

    • Drought stress: Plants deprived of water for 10 days followed by 48-hour recovery period

    • Cold stress: Plants exposed to -5°C for 24 hours followed by 48-hour recovery at normal conditions

These methodologies have revealed that WHAB1.6 enhances ROS accumulation under both drought and salt stresses, with the molecular mechanisms potentially involving changes in photosystem efficiency and energy dissipation pathways .

How does WHAB1.6 differ from other chlorophyll a-b binding proteins in its stress response functions?

WHAB1.6 exhibits several unique characteristics that distinguish it from other chlorophyll a-b binding proteins in terms of stress response:

  • Dual functionality:

    • Unlike many other LHC proteins that primarily serve photosynthetic functions, WHAB1.6 has a pronounced role in stress susceptibility

    • It functions as a susceptibility gene during pathogen infection, a characteristic not commonly reported for other chlorophyll binding proteins

  • Expression regulation under stress:

    • WHAB1.6 is specifically down-regulated under multiple stress conditions

    • This contrasts with other photosynthetic proteins that may be differentially regulated based on the specific stress type

  • ROS accumulation mechanism:

    • WHAB1.6 promotes ROS accumulation during stress, which is counter to the protective role of many other photosynthetic proteins

    • It strengthens BAX-induced cell death pathways, indicating a role in programmed cell death that extends beyond typical LHC functions

The differential characteristics of various light-harvesting proteins are summarized in Table 2:

ProteinPrimary RoleResponse to StressEffect on ROSRole in Pathogen Response
WHAB1.6Light harvesting & energy transferDown-regulatedEnhances accumulationPromotes pathogen colonization
TaLhc2Similar to WHAB1.6Down-regulatedEnhances accumulationSusceptibility gene
Lhca1PSI antennaGenerally maintainedMinimal effectNot directly implicated
Lhcb1PSII antennaVaries by stress typeMay reduce under some conditionsVariable effects
Lhcb2PSII antennaOften down-regulatedMay reduce under some conditionsNot directly implicated

Understanding these differences requires precise experimental approaches, including:

  • Comparative transcriptomics of multiple LHC genes under identical stress conditions

  • Protein-level quantification using specific antibodies for each LHC protein

  • Transgenic studies comparing phenotypes of plants overexpressing different LHC proteins

What are the optimal conditions for recombinant expression and purification of WHAB1.6?

The successful expression and purification of recombinant WHAB1.6 requires careful optimization of several parameters:

  • Expression system selection:

    • E. coli systems: Most commonly used, but may require codon optimization for plant proteins

    • Plant-based expression systems: Can provide proper post-translational modifications but with lower yields

    • Cell-free protein synthesis: Useful for proteins that may be toxic to host cells

  • Buffer composition for optimal stability:

    • Tris-based buffer systems with 50% glycerol have been optimized for this protein

    • Storage at -20°C for standard use, or -80°C for extended storage

    • Working aliquots can be stored at 4°C for up to one week

  • Purification strategy:

    • Affinity chromatography using His-tags or other fusion tags

    • The tag type is often determined during the production process based on optimal expression and folding

    • Size exclusion chromatography as a polishing step to ensure high purity

  • Quality control measures:

    • SDS-PAGE to verify size and purity

    • Western blot with specific antibodies to confirm identity

    • Functionality testing through pigment binding assays

It's important to note that repeated freezing and thawing should be avoided as this can lead to protein degradation and loss of activity . Researchers should prepare appropriate aliquots based on their experimental needs.

What analytical techniques are most reliable for studying chlorophyll binding by WHAB1.6?

Several analytical approaches have proven effective for investigating the chlorophyll binding properties of WHAB1.6:

  • Spectroscopic methods:

    • Absorption spectroscopy: Measures characteristic peaks of bound chlorophyll a and b

    • Fluorescence spectroscopy: Assesses energy transfer between bound pigments

    • Circular dichroism (CD): Provides information about protein secondary structure changes upon pigment binding

  • Chromatographic analysis:

    • HPLC analysis: Allows identification and quantification of bound pigments

    • Acetone extraction followed by HPLC analysis can identify specific chlorophyll species bound to the protein

    • Comparison with standards like chlorophyllide b can determine the exact nature of bound pigments

  • Binding affinity measurements:

    • Isothermal titration calorimetry (ITC): Determines binding constants and thermodynamic parameters

    • Surface plasmon resonance (SPR): Measures real-time binding kinetics

  • Structural approaches:

    • X-ray crystallography: Provides atomic-level details of pigment binding sites (challenging for membrane proteins)

    • Cryo-electron microscopy: Increasingly used for membrane protein structures

    • Molecular dynamics simulations: Can predict binding modes and stability

Research has shown that water-soluble chlorophyll-binding proteins like WHAB1.6 often bind chlorophyllide rather than chlorophyll, indicating their potential role in chlorophyll metabolism rather than just light harvesting . The aqueous solubility of the pigment combined with HPLC retention time identical to chlorophyllide b suggests that the pigment bound to related WSCPs is nonesterified .

How can contradictions in WHAB1.6 research data be systematically analyzed and resolved?

When facing contradictory results in WHAB1.6 research, a structured approach to contradiction analysis can help identify the source of discrepancies:

  • Categorization of contradiction types:

    • Apparent contradictions: May be due to incomplete reporting of experimental conditions

    • Context-dependent contradictions: Results that differ due to specific experimental conditions

    • Methodological contradictions: Discrepancies arising from different measurement techniques

    • Interpretative contradictions: Same data interpreted differently based on theoretical frameworks

  • Formal contradiction representation:

    • Use a notation system like (α, β, θ) where:

      • α = number of interdependent items being measured

      • β = number of contradictory dependencies defined by domain experts

      • θ = minimal number of Boolean rules needed to assess these contradictions

    • This formal representation helps in systematic analysis of complex contradictions

  • Experimental verification approaches:

    • Design experiments that specifically test contradictory findings under identical conditions

    • Use multiple complementary methods to measure the same parameter

    • Include appropriate controls that can distinguish between competing hypotheses

  • Meta-analysis techniques:

    • Pool data from multiple studies to identify patterns in results

    • Use statistical approaches to account for inter-study variability

    • Identify moderator variables that may explain differing results

Table 3 presents a framework for analyzing contradictions in WHAB1.6 research:

Contradiction TypeExample in WHAB1.6 ResearchResolution ApproachDocumentation Recommendation
Species/variety differencesDifferent stress responses in various wheat cultivarsTest multiple varieties under identical conditionsAlways specify exact genetic background
Environmental contextDifferent expression patterns under varying light conditionsSystematically vary single environmental parametersReport all environmental conditions in detail
Temporal variationsDifferent responses at early vs. late stages of stressTime-course experimentsReport precise timing of measurements
Methodological differencesTranscript vs. protein level discrepanciesUse multiple measurement techniquesClearly distinguish between mRNA and protein data

What emerging technologies hold promise for deeper understanding of WHAB1.6 function?

Several cutting-edge technologies are poised to advance our understanding of WHAB1.6:

  • CRISPR-Cas9 gene editing:

    • Precise manipulation of WHAB1.6 in wheat genome

    • Introduction of specific mutations to study structure-function relationships

    • Creation of tagged versions for in vivo tracking without overexpression artifacts

  • Single-cell transcriptomics:

    • Cell-type specific expression patterns of WHAB1.6

    • Identification of cell populations with differential regulation during stress

    • Correlation with cell-specific stress responses

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structural analysis of WHAB1.6 within native complexes

    • Visualization of conformational changes under different conditions

    • Insights into protein-pigment interactions at near-atomic resolution

  • Multi-omics integration approaches:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Network analysis to position WHAB1.6 within stress response pathways

    • Machine learning to predict WHAB1.6 function under novel conditions

  • Nanobody-based imaging techniques:

    • Development of WHAB1.6-specific nanobodies

    • Real-time tracking of protein localization and dynamics

    • Super-resolution microscopy applications

These technologies will help resolve current knowledge gaps, including the precise mechanism by which WHAB1.6 influences ROS accumulation and its dynamic interactions within the photosynthetic machinery during stress conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.