Recombinant Triticum aestivum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Functional Insights

cemA is an integral inner envelope membrane protein with roles hypothesized through comparative studies:

  • CO₂ Transport Homology: The cyanobacterial cotA gene, a cemA homolog, is essential for CO₂ uptake, suggesting cemA may participate in chloroplast ion or metabolite transport .

  • Male Sterility Linkage: In wheat, chloroplast genome mutations involving cemA correlate with cytoplasmic male sterility (CMS), potentially via disrupted thylakoid membrane dynamics or mitochondrial crosstalk .

  • Membrane Integration Mechanism: Unlike thylakoid-targeted proteins, cemA’s TMS regions avoid cotranslational engagement with thylakoid translocons, likely due to its N-terminal lysine-rich motif .

Research Applications

Recombinant cemA enables functional and structural studies:

  • Antibody Production: Used to generate antibodies for Western blotting and localization assays .

  • Protein-Protein Interaction Studies: Assays to identify partners in chloroplast envelope complexes .

  • CMS Mechanism Analysis: Investigated in wheat sterile lines via qPCR and gene silencing (BSMV-VIGS) .

Comparative Analysis

cemA homologs share structural and functional conservation:

SpeciesKey FeatureFunction
Oryza sativa (Rice)Lysine-rich N-terminus (MKKKKALPS...) Stromal pH regulation
SynechocystiscotA gene with 4 TMS domains CO₂ transport
ChlamydomonasPart of polycistronic atpA cluster Transcript processing studies

Technical Notes

  • Reconstitution: Lyophilized protein should be dissolved in Tris/PBS buffer (pH 8.0) with 5–50% glycerol for stability .

  • Avoidance of Degradation: Working aliquots stored at 4°C retain activity for ≤1 week .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Triticum aestivum (Wheat)
Target Names
cemA
Target Protein Sequence
MKKKKALPSLLYLVFIVLLPWGVSSSFNKCLELWIKNWWNTRQSETLLTDIQEKRILERF IELEELSLLDEMIKGKLKTHVQKPPTGIHKEIIQWVKINNEDHLHTILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSIKAFFILLVTDFFVGFHSTRGWELVIRWVYND FGWAPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.

Target Background

Function
May be involved in proton extrusion. Indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the function of cemA protein in Triticum aestivum chloroplasts?

The cemA protein (also known as ycf10) in Triticum aestivum functions as a chloroplast envelope membrane protein with several proposed roles in plant cellular processes. Based on homology with cemA in other plant species like Oryza sativa, this protein likely plays a critical role in chloroplast function, potentially involved in CO₂ uptake and photosynthetic efficiency .

The protein consists of approximately 230 amino acids with multiple transmembrane domains that anchor it within the chloroplast envelope membrane. While specific research on wheat cemA is limited, studies in related species suggest it contributes to:

  • Regulation of inorganic carbon uptake into chloroplasts

  • Maintenance of optimal photosynthetic efficiency

  • Possible roles in chloroplast development and stress response

Researchers investigating cemA function should consider its hydrophobic nature as a membrane protein when designing experimental approaches for functional characterization.

How do the expression systems for recombinant Triticum aestivum cemA protein compare to those used for other plant chloroplast proteins?

Expression SystemAdvantagesLimitationsSuitability for cemA
E. coliHigh yield, rapid growth, cost-effective, established protocolsLimited post-translational modifications, potential incorrect folding of membrane proteinsGood for initial studies, requires optimization for membrane proteins
Yeast (P. pastoris)Eukaryotic system, better folding of complex proteins, moderate yieldLonger expression time, glycosylation patterns differ from plantsBetter for functional studies requiring proper folding
Insect cellsSuperior folding for complex proteins, good for membrane proteinsExpensive, technically demanding, slower growthExcellent for structural studies requiring native conformation
Plant-based systemsNative post-translational modifications, natural folding environmentLower yield, time-consuming, more complex protocolsIdeal for functional studies requiring authentic modifications

For wheat cemA specifically, successful expression in E. coli can be achieved by:

  • Using low temperature induction (16-20°C)

  • Employing specialized E. coli strains designed for membrane proteins

  • Including solubilizing tags (His-tag is commonly used)

  • Optimizing codon usage for bacterial expression

What purification strategies are most effective for recombinant His-tagged cemA protein?

Purification of His-tagged cemA protein requires specialized approaches due to its membrane-integrated nature. Based on protocols used for similar chloroplast membrane proteins and the rice cemA homolog, the following methodology is recommended:

  • Cell Lysis Optimization:

    • Use mild detergents such as n-dodecyl β-D-maltoside (DDM) or CHAPS for membrane solubilization

    • Employ gentle sonication or French press techniques to preserve protein structure

    • Maintain cold temperatures (4°C) throughout the process

  • Affinity Chromatography Protocol:

    • Use Ni-NTA resin for His-tagged protein binding

    • Include detergent in all buffers (typically 0.05-0.1% DDM)

    • Apply gradual imidazole gradient for selective elution

    • Consider using Tris/PBS-based buffers with 6% trehalose to stabilize the protein

  • Post-Purification Processing:

    • Dialysis against buffer containing decreasing detergent concentrations

    • Concentrate protein using specialized filters for membrane proteins

    • Consider adding glycerol (30-50%) for storage stability

    • Aliquot and store at -80°C to prevent freeze-thaw degradation

The purity can typically be assessed via SDS-PAGE, with expected purity levels above 90% for properly optimized protocols .

How can researchers overcome expression challenges for wheat cemA protein in heterologous systems?

Expressing membrane proteins like cemA presents several challenges that researchers must address through methodological optimizations:

  • Toxicity to Host Cells:

    • Implement tightly regulated inducible promoters (T7lac or araBAD)

    • Use specialized E. coli strains with enhanced membrane protein tolerance (C41/C43)

    • Test varying induction strengths to balance expression and toxicity

  • Inclusion Body Formation:

    • Reduce expression temperature to 16-20°C

    • Add membrane-mimetic compounds to growth media

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Explore fusion partners that enhance solubility

  • Improper Folding:

    • Include appropriate detergents during cell lysis and purification

    • Reconstitute in lipid nanodiscs or liposomes post-purification

    • Use circular dichroism to verify secondary structure formation

For wheat cemA specifically, researchers should consider:

  • Starting with the established amino acid sequence data from related species

  • Optimizing codons for E. coli expression while preserving critical sequence features

  • Designing constructs with removable fusion tags to enhance expression while enabling native protein recovery

What structural analysis methods are appropriate for characterizing the Triticum aestivum cemA protein?

Multiple complementary techniques can be employed to elucidate the structural characteristics of wheat cemA protein:

Based on the amino acid sequence data from related cemA proteins , researchers should pay particular attention to predicted transmembrane regions and potential functional domains when designing structural studies.

How do post-translational modifications affect cemA protein function in wheat compared to other cereals?

Post-translational modifications (PTMs) are critical for proper folding, localization, and function of chloroplast proteins including cemA. While specific data on wheat cemA PTMs is limited, researchers can investigate this area through:

  • PTM Prediction and Analysis:

    • Phosphorylation sites can be predicted using tools like NetPhos

    • Mass spectrometry-based approaches to identify actual modifications

    • Comparison with known modifications in homologous proteins

  • Functional Impact Assessment:

    • Site-directed mutagenesis of predicted PTM sites

    • Activity assays comparing wild-type and mutant proteins

    • Localization studies using fluorescently tagged constructs

  • Comparative Analysis Across Species:

    • Alignment of wheat cemA with rice cemA and other cereal homologs

    • Identification of conserved potential modification sites

    • Correlation with functional differences between species

PTMs likely to be relevant for cemA include:

  • Phosphorylation (regulating protein-protein interactions)

  • Acetylation (potentially affecting membrane integration)

  • Lipid modifications (enhancing membrane association)

What are the best experimental approaches to investigate cemA protein interactions with other chloroplast components?

Understanding protein-protein and protein-lipid interactions is crucial for elucidating cemA function. Researchers can employ multiple complementary approaches:

  • In Vitro Interaction Studies:

    • Pull-down assays using purified His-tagged cemA protein

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

    • Microscale thermophoresis for detecting interactions in solution

    • Reconstitution in liposomes with potential interaction partners

  • In Vivo Interaction Analysis:

    • Split-GFP or FRET-based assays in plant chloroplasts

    • Co-immunoprecipitation from wheat chloroplast extracts

    • Proximity labeling methods (BioID, APEX) to identify neighboring proteins

    • Genetic approaches (suppressor screens, synthetic lethality)

  • Structural Basis of Interactions:

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry for conformational changes

    • Computational docking and molecular dynamics simulations

When investigating wheat cemA interactions, researchers should consider:

  • The hydrophobic nature of the protein requiring specialized detergents

  • The need to distinguish direct from indirect interactions

  • Potential differences in interaction partners under various stress conditions

How might cemA protein contribute to wheat stress response mechanisms?

The chloroplast envelope membrane plays crucial roles in plant stress responses. While direct evidence for wheat cemA involvement is limited, researchers can investigate its potential roles through:

  • Expression Analysis Under Stress:

    • qRT-PCR or RNA-seq of cemA transcripts under various stresses

    • Western blot analysis of protein levels using specific antibodies

    • Correlation with photosynthetic efficiency parameters

  • Genetic Approaches:

    • CRISPR/Cas9 knockout or knockdown studies

    • Overexpression analysis in wheat or model systems

    • Complementation studies with mutated versions

  • Physiological Assessment:

    • Measurement of CO₂ uptake in plants with altered cemA expression

    • Chlorophyll fluorescence to assess photosynthetic efficiency

    • Reactive oxygen species (ROS) measurement under stress conditions

Based on studies in other plant species, wheat cemA might contribute to:

  • Drought stress responses through regulated CO₂ uptake

  • Temperature stress adaptation through membrane fluidity modulation

  • Oxidative stress mitigation through chloroplast homeostasis maintenance

How can researchers evaluate the potential of cemA as a target for wheat improvement?

To assess whether cemA could serve as a valuable target for crop improvement, researchers should implement a systematic evaluation approach:

A potential research pipeline would involve initial characterization of recombinant protein function , followed by in planta validation, and ultimately field testing of promising variants.

What methodological approaches can differentiate between direct and indirect effects of cemA protein on photosynthetic efficiency?

Distinguishing direct from indirect effects requires carefully designed experiments:

  • Time-Resolved Studies:

    • Short-term measurements immediately following cemA perturbation

    • Long-term adaptive responses monitoring

    • Inducible expression systems for temporal control

  • Compartment-Specific Analyses:

    • Sub-organellar fractionation to isolate envelope membranes

    • In vitro reconstitution with defined components

    • Targeted protein delivery to specific compartments

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Network analysis to identify direct interaction partners

    • Flux analysis to determine metabolic impacts

  • Single-Cell or Organelle Analysis:

    • Isolated chloroplast studies with controlled cemA manipulation

    • Patch-clamp studies of envelope membrane transport

    • Microfluidic approaches for single organelle manipulation

Researchers should implement appropriate controls, including structurally similar but functionally distinct proteins, to validate cemA-specific effects on photosynthetic parameters.

What are the most common technical challenges when working with recombinant wheat cemA protein and how can they be addressed?

Researchers frequently encounter several technical obstacles when working with cemA:

  • Low Expression Yields:

    • Problem: Membrane proteins often express poorly

    • Solution: Optimize codon usage, reduce temperature to 16°C, use specialized strains like C41(DE3), and test different fusion tags

  • Protein Aggregation:

    • Problem: cemA tends to aggregate during extraction and purification

    • Solution: Include appropriate detergents (DDM, CHAPS), add stabilizers like trehalose , and maintain cold temperatures throughout

  • Antibody Specificity:

    • Problem: Generating specific antibodies against membrane proteins is challenging

    • Solution: Use peptide antigens from hydrophilic regions, purify antibodies against recombinant protein, validate specificity against knockout lines

  • Functional Assays:

    • Problem: Difficult to assess function of isolated membrane proteins

    • Solution: Develop liposome reconstitution systems, use complementation in heterologous systems, employ in vitro transport assays

  • Storage Stability:

    • Problem: Membrane proteins often lose activity during storage

    • Solution: Add glycerol (30-50%) , store in small aliquots to avoid freeze-thaw cycles, and validate activity before experiments

Careful optimization of each step from expression to storage will significantly improve success rates when working with this challenging protein.

How should researchers interpret and reconcile contradictory results from different experimental approaches studying cemA function?

When faced with conflicting data about cemA function, researchers should employ a systematic reconciliation approach:

  • Methodological Evaluation:

    • Compare experimental conditions (pH, temperature, ionic strength)

    • Assess protein quality and conformation in each study

    • Examine temporal aspects of measurements

  • System Complexity Analysis:

    • Consider differences between in vitro and in vivo systems

    • Evaluate potential compensatory mechanisms in whole-organism studies

    • Assess tissue or developmental stage-specific effects

  • Integrated Data Analysis:

    • Apply meta-analysis techniques to published results

    • Use Bayesian approaches to weight evidence based on methodological strength

    • Develop computational models that can accommodate apparently contradictory data

  • Decisive Experiments:

    • Design experiments specifically to distinguish between competing hypotheses

    • Use orthogonal techniques to verify key findings

    • Implement controls that can identify system-specific artifacts

This structured approach enables researchers to build coherent models of cemA function despite seemingly contradictory experimental outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.