Recombinant Triticum aestivum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Triticum aestivum Cytochrome b6 (petB)

Recombinant Triticum aestivum Cytochrome b6 (petB) is a genetically engineered protein derived from wheat (common wheat, Triticum aestivum), expressed in E. coli for research and industrial applications. It represents the b6 subunit of the cytochrome b6f (cytb6f) complex, a critical component of the photosynthetic electron transport chain (ETC) in plants. This recombinant form is fused with an N-terminal His-tag to facilitate purification and downstream applications, such as structural studies or biochemical assays .

Protein Structure

  • Sequence and Length: The recombinant protein spans residues 1–222aa (full-length) or 50–222aa (truncated) in T. aestivum, depending on the construct design .

  • Post-Translational Modifications: The His-tag enables affinity chromatography for high-purity isolation .

PropertyValueSource
UniProt IDQ7X9A6 (truncated) or P28058 (full-length)
Gene NamepetB
Expression SystemE. coli
TagN-terminal His-tag
Storage BufferTris-based buffer + 50% glycerol (stored at -20°C)

Biological Role

Cytochrome b6 (petB) is integral to the cytb6f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI). Key functions include:

  • Electron Transfer: Oxidizes plastoquinol (PQH₂) and reduces plastocyanin, generating a proton gradient for ATP synthesis .

  • Complex Assembly: Interacts with other subunits (e.g., PetC, PetA) to stabilize the cytb6f dimer structure .

Functional Studies

  • Interaction Mapping: Co-immunoprecipitation (Co-IP) assays in rice and Nicotiana benthamiana confirmed PetB’s interaction with PetC, a Rieske iron-sulfur protein critical for cytb6f activity .

  • Electron Transport Regulation: Overexpression of cytb6f subunits (e.g., PetC) in plants enhances photosynthetic efficiency, suggesting PetB’s role in modulating electron flux .

StudyKey FindingsSource
PetC-PetB InteractionDirect interaction confirmed via Co-IP and BiFC assays in plant protoplasts
Cytochrome c6 OverexpressionEnhanced electron transport and biomass in Arabidopsis and tobacco
PetN DeficiencyDisrupted cytb6f stability and state transitions in cyanobacteria

Expression and Yield

  • Host Organism: E. coli is the primary host for scalable production .

  • Purification: Ni-NTA affinity chromatography isolates the His-tagged protein with >95% purity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Triticum aestivum (Wheat)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what is its significance in wheat?

Cytochrome b6 (petB) is a critical protein component of the cytochrome b6/f complex involved in photosynthetic electron transport in wheat (Triticum aestivum). This transmembrane protein plays an essential role in the electron transfer between photosystem II and photosystem I during photosynthesis. In wheat, as in other photosynthetic organisms, this protein is crucial for energy harvesting and metabolism, directly impacting plant productivity. The petB gene is encoded in the wheat genome, which contains approximately 94,000-96,000 genes distributed across its hexaploid (A, B, and D) genome structure . Understanding Cytochrome b6 function provides insights into wheat's photosynthetic efficiency and potential avenues for crop improvement.

How is recombinant Triticum aestivum Cytochrome b6 typically expressed and purified?

Recombinant Triticum aestivum Cytochrome b6 is typically expressed in bacterial systems, with E. coli being the most common expression host . The process generally involves:

  • Cloning the full-length petB coding sequence from wheat cDNA into an expression vector with an appropriate tag (commonly His-tag for purification)

  • Transforming the construct into a suitable E. coli strain such as ArcticExpress (DE3), which provides better protein folding at lower temperatures

  • Inducing expression at lower temperatures (12-15°C) with IPTG to enhance proper folding

  • Lysing cells and purifying the protein using affinity chromatography

The specific protocol often involves growth of transformed E. coli cells to OD600 of 0.6 at 37°C, followed by temperature reduction to approximately 13°C, and induction with 500 μM IPTG for extended expression periods (16+ hours) . Purification typically employs single-step affinity chromatography using the His-tag, followed by buffer exchange into a Tris/PBS-based buffer containing stabilizers such as trehalose .

What are the optimal storage conditions for recombinant wheat petB protein?

Recombinant Cytochrome b6 from wheat is typically stored as a lyophilized powder or in solution with cryoprotectants. Based on established protocols for similar recombinant proteins, the following storage recommendations apply:

  • Store lyophilized protein at -20°C to -80°C

  • For reconstituted protein, add glycerol to a final concentration of 30-50% and store in small aliquots at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Working aliquots can be stored at 4°C for up to one week

For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. The reconstitution buffer typically contains Tris/PBS with 6% trehalose at pH 8.0 to maintain protein stability .

How can researchers verify the identity and activity of recombinant wheat Cytochrome b6?

Verification of recombinant wheat Cytochrome b6 identity and activity requires multiple complementary approaches:

Identity Verification:

  • SDS-PAGE analysis to confirm molecular weight (expected size approximately 24-25 kDa)

  • Western blotting using specific antibodies against Cytochrome b6

  • Mass spectrometry to confirm peptide mass fingerprinting against known sequences

  • N-terminal sequencing to verify the start of the protein

Activity Assessment:

  • Spectrophotometric analysis to assess heme incorporation (absorption peaks at characteristic wavelengths)

  • Electron transfer assays using artificial electron donors and acceptors

  • Reconstitution experiments with other components of the cytochrome b6/f complex

The recombinant protein sequence can be verified against reference sequences such as P28058 (from Prochlorothrix hollandica, as an example) . Researchers should expect purity greater than 90% as determined by SDS-PAGE for commercially available preparations.

What antibodies are available for detecting wheat Cytochrome b6, and how should they be validated?

Several antibodies are available for detecting Cytochrome b6 in wheat research, with polyclonal antibodies being most common. For example, antibodies against the related Rieske iron-sulfur protein of the Cyt b6/f complex (PetC) have been developed and validated for use in multiple plant species including Triticum aestivum .

Validation Protocol:

  • Western blotting against purified recombinant protein and native wheat protein extracts

  • Immunoprecipitation followed by mass spectrometry

  • ELISA assays with serial dilutions to determine sensitivity and specificity

  • Dot blot analysis against related proteins to assess cross-reactivity

When validating antibodies, researchers should follow protocols similar to those used for anti-RHT-D1A antibodies in wheat:

  • Block membranes with 5% nonfat dry milk in TBST (50 mM Tris-HCl pH 7.6, 150 mM NaCl, 0.005% Tween 20)

  • Incubate primary antibody at appropriate dilutions (typically 1:5,000 to 1:10,000) overnight at 4°C

  • Wash thoroughly with TBST buffer

  • Incubate with secondary antibody (typically goat anti-rabbit at 1:20,000 dilution)

  • Develop using appropriate detection methods

Quantitative validation can be performed using ELISA, where absorbance at 405 nm (A405) is measured after incubation with alkaline phosphatase-conjugated secondary antibodies and p-Nitrophenyl phosphate substrate .

What are the challenges in expressing full-length functional Cytochrome b6 from wheat?

Expressing full-length functional Cytochrome b6 from wheat presents several challenges:

Membrane Protein Expression Challenges:

  • Cytochrome b6 is a transmembrane protein with multiple membrane-spanning domains, making proper folding difficult in bacterial expression systems

  • The hydrophobic nature of the protein can lead to aggregation and inclusion body formation

  • Proper heme incorporation is essential for functionality but challenging to achieve in heterologous systems

Wheat-Specific Challenges:

  • The hexaploid nature of the wheat genome (AABBDD) means there may be multiple homoeologous copies of petB with subtle sequence variations

  • Codon optimization may be necessary when expressing wheat genes in bacterial systems

  • Post-translational modifications present in wheat may be absent in bacterial expression systems

Methodological Solutions:

  • Use specialized E. coli strains like ArcticExpress (DE3) that co-express chaperonins to assist proper folding

  • Express at lower temperatures (12-15°C) to slow folding and improve proper structure formation

  • Add heme precursors to the growth medium

  • Consider using wheat germ cell-free expression systems for more native-like protein production

How can recombinant Cytochrome b6 be used to study wheat response to environmental stresses?

Recombinant Cytochrome b6 can serve as a valuable tool for understanding wheat's photosynthetic responses to environmental stresses through several experimental approaches:

Comparative Protein Analysis:

  • Generate recombinant versions of Cytochrome b6 containing stress-induced mutations or modifications

  • Compare the electron transport efficiency of wild-type versus modified proteins

  • Analyze structural changes using circular dichroism or other spectroscopic methods

In vitro Stress Simulation:

  • Subject purified recombinant Cytochrome b6 to various stress conditions (high salt, temperature extremes, reactive oxygen species)

  • Measure changes in protein stability, conformation, and activity

  • Use these data to model in vivo responses

Protein-Protein Interaction Studies:

  • Use recombinant Cytochrome b6 as bait in pull-down assays to identify stress-responsive interaction partners

  • Perform binding assays under different simulated stress conditions

  • Map interaction domains critical for stress response

Research has shown that proteins involved in energy harvesting and metabolism, like Cytochrome b6, are among expanded gene families in wheat that could be associated with crop productivity . Analysis of protein accumulation under different light conditions has revealed that many photosynthetic proteins show highest accumulation under high-light conditions, suggesting their importance in light stress responses .

What techniques are most effective for studying protein-protein interactions involving wheat Cytochrome b6?

Several complementary techniques are recommended for studying protein-protein interactions involving wheat Cytochrome b6:

In vitro Methods:

  • Pull-down Assays: Using His-tagged recombinant Cytochrome b6 to capture interaction partners from wheat extracts

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between Cytochrome b6 and purified partner proteins

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of protein interactions

In vivo Methods:

  • Blue Native PAGE (BN-PAGE): To preserve native protein complexes and identify components of the Cytochrome b6/f complex in wheat

  • Co-immunoprecipitation: Using specific antibodies against Cytochrome b6 to precipitate the protein along with its binding partners

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing protein interactions in plant cells

High-throughput Approaches:

  • Yeast two-hybrid screening: Using Cytochrome b6 domains as bait to screen wheat cDNA libraries

  • Protein arrays: Testing interactions against multiple wheat proteins simultaneously

  • Mass spectrometry-based interactomics: Identifying all proteins that co-purify with tagged Cytochrome b6

When analyzing results, researchers should be aware that the membrane localization of Cytochrome b6 may require specialized approaches, such as the use of mild detergents to maintain native-like membrane environments during experiments.

How does wheat Cytochrome b6 function relate to advances in wheat genome research?

The function of wheat Cytochrome b6 should be contextualized within recent advances in wheat genome research:

Genomic Context:

  • The bread wheat genome is exceptionally large (17 Gb) and complex, with a hexaploid structure consisting of A, B, and D genomes

  • Between 94,000-96,000 genes have been identified in wheat, with approximately two-thirds assigned to the A, B, and D genomes

  • High-resolution synteny maps have identified many small disruptions to conserved gene order when compared to model species like Brachypodium distachyon

Functional Genomics Approaches:

  • Analysis of homoeologous petB genes across the A, B, and D genomes to identify subfunctionalization or neofunctionalization

  • Examination of gene expression patterns across tissues, developmental stages, and stress conditions

  • Comparison with orthologous genes in related species to identify wheat-specific adaptations

Integration with Breeding Programs:

  • Identification of natural variation in petB sequences that correlate with photosynthetic efficiency

  • Development of molecular markers for selecting varieties with optimized photosynthetic capacity

  • Potential for targeted modification of Cytochrome b6 to enhance wheat productivity

Research has shown that the wheat genome is highly dynamic, with significant loss of gene family members upon polyploidization and domestication . Understanding how Cytochrome b6 has evolved within this context can provide insights into wheat adaptation and potential targets for improvement.

What are common issues in recombinant wheat Cytochrome b6 expression and how can they be resolved?

Researchers working with recombinant wheat Cytochrome b6 frequently encounter several challenges that can be addressed through specific troubleshooting approaches:

IssuePossible CausesSolutions
Low expression yieldCodon bias, toxicity to host cells, mRNA instabilityUse codon-optimized sequences, use tightly regulated promoters, check for rare codons
Inclusion body formationRapid expression, improper folding, hydrophobic domainsLower induction temperature (13°C), reduce IPTG concentration, add solubility tags
Lack of heme incorporationInsufficient heme in growth medium, improper protein foldingSupplement medium with δ-aminolevulinic acid, co-express heme biosynthesis genes
Protein degradationProtease activity, intrinsic instabilityAdd protease inhibitors, use protease-deficient strains, optimize buffer conditions
Poor solubilityHydrophobic transmembrane domainsUse mild detergents (DDM, LDAO), consider membrane mimetics

When expressing transmembrane proteins like Cytochrome b6, the ArcticExpress (DE3) strain can be particularly effective as it allows for expression at low temperatures (13°C) with extended induction times (16+ hours) , which significantly improves proper folding and reduces inclusion body formation.

How can researchers assess the quality and integrity of purified recombinant wheat Cytochrome b6?

Quality assessment of purified recombinant wheat Cytochrome b6 should include multiple complementary approaches:

Purity Assessment:

  • SDS-PAGE analysis with Coomassie staining (expecting >90% purity)

  • Size exclusion chromatography to detect aggregates or degradation products

  • Western blotting to confirm identity and detect any degradation fragments

Structural Integrity:

  • Circular dichroism spectroscopy to assess secondary structure content

  • Fluorescence spectroscopy to evaluate tertiary structure

  • UV-visible absorption spectroscopy to confirm proper heme incorporation (characteristic peaks)

Functional Assessment:

  • Electron transfer activity assays using artificial electron donors/acceptors

  • Binding assays with known interaction partners

  • Thermal stability assays to determine protein stability

For storing purified protein, researchers should reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol to a final concentration of 30-50%. The preparation should be aliquoted to avoid repeated freeze-thaw cycles and stored at -20°C to -80°C for long-term storage .

How does wheat Cytochrome b6 research connect to sustainable agriculture initiatives?

Research on wheat Cytochrome b6 has significant implications for sustainable agriculture:

Photosynthetic Efficiency:

  • Cytochrome b6 is a critical component of the photosynthetic electron transport chain, directly impacting energy conversion efficiency

  • Understanding variations in Cytochrome b6 function across wheat varieties may reveal opportunities for selecting or engineering varieties with enhanced photosynthetic capacity

  • Improved photosynthesis directly contributes to increased yield potential with the same or reduced resource inputs

Stress Tolerance:

  • The photosynthetic apparatus, including Cytochrome b6, is particularly vulnerable to environmental stresses

  • Research on how Cytochrome b6 structure and function respond to drought, heat, and light stress can inform breeding programs focused on climate resilience

  • Varieties with more robust Cytochrome b6 function under stress may maintain productivity in challenging environments

Resource Use Efficiency:

  • More efficient electron transport contributes to better nitrogen and water use efficiency

  • Understanding the molecular basis of this efficiency can guide precision breeding approaches

  • Targeted modifications of Cytochrome b6 or its regulatory elements could enhance resource use efficiency

Considering that bread wheat accounts for 20% of the calories consumed by mankind , even modest improvements in photosynthetic efficiency through optimized Cytochrome b6 function could have substantial impacts on global food security.

What emerging technologies are changing how researchers study wheat Cytochrome b6?

Several emerging technologies are transforming research approaches to wheat Cytochrome b6:

Cryo-Electron Microscopy:

  • Enables high-resolution structural analysis of membrane protein complexes like Cytochrome b6/f without crystallization

  • Allows visualization of dynamic states and conformational changes during electron transport

  • Provides insights into wheat-specific structural features compared to model organisms

CRISPR/Cas9 Genome Editing:

  • Permits precise modification of endogenous petB genes in wheat

  • Enables creation of tagged versions of Cytochrome b6 for in vivo studies

  • Allows functional testing of sequence variations observed between wheat varieties

Single-Molecule Techniques:

  • Single-molecule FRET to study conformational dynamics during electron transport

  • Optical tweezers to investigate mechanical properties of protein-protein interactions

  • Nanopore analysis for studying membrane insertion and topology

Integrative Multi-Omics:

  • Combining transcriptomics, proteomics, and metabolomics to understand Cytochrome b6 in its broader cellular context

  • Network analysis to identify regulatory relationships affecting Cytochrome b6 expression and function

  • Machine learning approaches to predict how sequence variations impact function

These technologies allow researchers to move beyond traditional biochemical approaches to understand Cytochrome b6 function in unprecedented detail and within its native cellular environment.

What are the most promising future research directions for wheat Cytochrome b6 studies?

Research on wheat Cytochrome b6 is poised to advance in several promising directions:

  • Comparative analysis of Cytochrome b6 sequence, structure, and function across diverse wheat germplasm to identify natural variations that enhance photosynthetic efficiency

  • Investigation of how Cytochrome b6 and the cytochrome b6/f complex respond to combined stresses (heat+drought, light+heat) that mimic real-world conditions wheat faces under climate change

  • Development of wheat varieties with optimized Cytochrome b6 function through precision breeding or genome editing approaches

  • Exploration of the role of Cytochrome b6 in signaling networks that coordinate chloroplast and nuclear gene expression in response to environmental changes

  • Integration of structural biology with in silico modeling to predict how specific amino acid changes might affect electron transport efficiency

These research directions build upon our current understanding while leveraging new technologies to address pressing challenges in wheat improvement and sustainable agriculture.

How can researchers effectively integrate wheat Cytochrome b6 studies with other aspects of plant science?

To maximize impact, wheat Cytochrome b6 research should be integrated with other plant science disciplines:

Integration with Systems Biology:

  • Place Cytochrome b6 within genome-scale metabolic models of wheat

  • Identify emergent properties that arise from interactions between photosynthetic and other metabolic pathways

  • Use network analysis to predict consequences of perturbations to Cytochrome b6 function

Connection to Field-Level Phenotyping:

  • Correlate molecular-level Cytochrome b6 measurements with canopy-level photosynthetic parameters

  • Develop high-throughput phenotyping methods that can serve as proxies for Cytochrome b6 function in large populations

  • Bridge lab and field studies to ensure laboratory findings translate to real-world conditions

Interdisciplinary Collaboration:

  • Work with computational biologists to model electron transport dynamics

  • Partner with agronomists to test hypotheses under diverse field conditions

  • Engage with breeding programs to implement findings in variety development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.