Recombinant Triticum aestivum Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it; we will prioritize its inclusion.
Synonyms
COX2; COII; COXII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Triticum aestivum (Wheat)
Target Names
COX2
Target Protein Sequence
MILRSLSCRFLTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVLWMLV RALWHFNEQTNPIPQRIVHGTTIEIIWTIFPSVILLFIAIPSFALLYSMDGVLVDPAITI KAIGHQWYWTYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRM IVTPADVLHSWAVPSLGVKCDAVPGRLNLTSILVQREGVYYGQCSEICGTNHAFMPIVVE AVTLKDYADWVSNQLILQTN
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprising succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. COX2 plays a crucial role in the reduction of oxygen to water within the cytochrome c oxidase complex. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme a3 and CuB. The BNC utilizes four electrons from cytochrome c and four protons from the matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Triticum aestivum Cytochrome c oxidase subunit 2 and how does it differ from human COX-2?

Triticum aestivum (wheat) Cytochrome c oxidase subunit 2 (COX2) is a core component of the mitochondrial respiratory chain complex IV. It's important to note that wheat COX2 should not be confused with human cyclooxygenase-2 (COX-2/PTGS2). Human COX-2 is a dimeric, heme-dependent enzyme with an N-terminal EGF-like domain, a membrane binding domain, and a C-terminal catalytic domain that catalyzes the conversion of arachidonate to prostaglandin H2 . In contrast, mitochondrial COX2 contains a dual core CuA active site and functions in the electron transport chain, catalyzing the oxidation of cytochrome c .

The typical molecular mass of mitochondrial COX2 proteins is approximately 26-30 kDa, as seen in the insect COX2 example which has a molecular mass of 26.2 kDa with a pI value of 6.37 . When expressing and studying wheat COX2, researchers should be mindful of this fundamental distinction to avoid confusion with the inflammatory enzyme COX-2/PTGS2 that is targeted by NSAIDs and selective COX-2 inhibitors .

What expression systems are most effective for producing recombinant wheat COX2?

For recombinant wheat COX2 expression, several systems merit consideration:

  • Bacterial Systems: E. coli expression systems similar to those used for insect COX2 can be adapted. The gene can be subcloned into vectors like pET-32a and expressed in strains such as E. coli Transetta (DE3), with induction by IPTG .

  • Insect Cell Systems: Spodoptera frugiperda (Sf21) cells with baculovirus expression systems have been successfully used for recombinant human COX-2 , suggesting this approach might be viable for wheat COX2 as well.

  • Wheat Germ Extract: Wheat germ cell-free systems have been used to express human proteins and may be particularly suitable for wheat proteins, potentially preserving native folding and post-translational modifications.

The optimal expression system should be selected based on specific research requirements, including needed protein yield, downstream applications, and whether post-translational modifications are essential for function.

What purification strategies yield the highest recovery of functional wheat COX2?

Based on established protocols for similar proteins, a multi-step purification strategy is recommended:

  • Affinity Chromatography: For His-tagged recombinant wheat COX2, Ni(2+)-NTA agarose affinity chromatography provides an efficient first purification step . This approach typically yields protein with approximately 80-90% purity.

  • Additional Purification Steps: For higher purity, consider:

    • Size exclusion chromatography to separate oligomeric states and remove aggregates

    • Ion exchange chromatography for removing contaminants with different charge profiles

  • Buffer Optimization: Based on protocols for similar proteins, consider using buffers containing:

    • 50 mM Tris, pH 8.0 as a base buffer

    • 5 μM Hemin as a stabilizing cofactor for heme-containing proteins

    • Appropriate protease inhibitors to prevent degradation

The purification protocol should be validated by SDS-PAGE analysis under both reducing and non-reducing conditions, with visualization by Coomassie Blue staining to assess purity and integrity .

How can the functional activity of purified wheat COX2 be verified?

To verify that purified recombinant wheat COX2 retains its functional activity:

  • Spectrophotometric Analysis: Monitor the oxidation of reduced cytochrome c at 550 nm, which measures electron transfer activity. UV-spectrophotometer analysis can confirm the protein's ability to catalyze substrate oxidation .

  • Oxygen Consumption Assays: Measure oxygen consumption using an oxygen electrode or fluorescence-based methods to quantify the complete reaction.

  • Activity Assay Components: Based on protocols for similar enzymes, consider:

    • Assay Buffer: 50 mM Tris, pH 8.0

    • Substrate: Cytochrome c (reduced form)

    • Detection methods: Direct spectrophotometric measurement or coupled assays

A functional wheat COX2 should demonstrate concentration-dependent catalytic activity with appropriate kinetic parameters that can be determined through Michaelis-Menten analysis.

How can recombinant wheat COX2 be used to study plant mitochondrial function under stress conditions?

Recombinant wheat COX2 provides a valuable tool for studying plant mitochondrial responses to stress:

  • In vitro Stress Simulation: Purified recombinant wheat COX2 can be subjected to various stress conditions (temperature, pH, oxidative stress) to assess direct effects on enzyme activity and stability.

  • Interaction Studies: Investigate how stress-related proteins interact with COX2 using techniques such as:

    • Pull-down assays with tagged recombinant COX2

    • Surface plasmon resonance to measure binding kinetics

    • Biolayer interferometry for real-time interaction analysis

  • Comparative Analysis: Compare the activity and stability of recombinant wheat COX2 with variants from stress-tolerant wheat varieties to identify adaptive differences.

  • Mutation Analysis: Create site-directed mutants of key residues in wheat COX2 to determine their roles in stress response, similar to the approach used to study binding sites in other proteins .

This research can provide valuable insights into how mitochondrial function adapts to environmental stressors in crop plants, potentially informing breeding strategies for stress-tolerant wheat varieties.

What approaches are recommended for studying the structural basis of wheat COX2 function?

Several complementary approaches can elucidate the structural basis of wheat COX2 function:

  • Homology Modeling: Generate structural models based on known structures of COX2 from other species, which can provide initial insights into functional domains.

  • Site-Directed Mutagenesis: Systematically mutate key residues identified through sequence conservation or modeling, then assess functional consequences. For example, studying hydrogen bond formation between specific amino acids and substrates, similar to the observation that a sulfur atom in AITC can form a 2.9 Å hydrogen bond with Leu-31 in insect COX2 .

  • X-ray Crystallography: For high-resolution structural determination, optimize crystallization conditions for purified wheat COX2, potentially including:

    • Screening different precipitants and additives

    • Co-crystallization with substrates or inhibitors

    • Using fusion partners to enhance crystallization

  • Cryo-Electron Microscopy: For challenging proteins that resist crystallization, cryo-EM can provide structural insights, particularly for COX2 as part of larger complexes.

Understanding the structural basis of wheat COX2 function can inform rational design of mutations to investigate specific aspects of mitochondrial function in crop plants.

What strategies can overcome low expression yields of recombinant wheat COX2?

When facing challenges with low expression yields:

  • Codon Optimization: Adapt the wheat COX2 coding sequence to the codon usage preferences of the expression host to enhance translation efficiency.

  • Fusion Tags Selection: Test different fusion partners to enhance solubility and expression:

    • Thioredoxin (Trx) tag for enhancing solubility

    • SUMO tag for improving folding

    • MBP (Maltose Binding Protein) for increasing solubility and providing an additional purification option

  • Expression Conditions Optimization:

    • Temperature: Lower temperatures (16-25°C) often improve folding

    • Induction timing: Induce at optimal cell density (typically mid-log phase)

    • Inducer concentration: Titrate IPTG concentration between 0.1-1.0 mM

    • Duration: Optimize between shorter periods for reducing toxicity and longer periods for maximum yield

  • Expression Host Selection: Test multiple expression hosts to identify the optimal system:

Expression SystemAdvantagesConsiderations
E. coliQuick growth, high yieldsMay lack post-translational modifications
Insect cellsBetter folding, modificationsLonger culture time, more complex
Wheat germ extractNative environment for plant proteinsLower yields, higher cost

Systematic optimization of these parameters can significantly improve recombinant wheat COX2 expression yields.

How can protein aggregation issues be resolved when working with wheat COX2?

Protein aggregation is a common challenge with membrane-associated proteins like COX2:

  • Buffer Optimization:

    • Include mild detergents (0.1% Triton X-100, 0.5% CHAPS)

    • Add stabilizing agents (10% glycerol, 100-250 mM NaCl)

    • Test different pH conditions (typically pH 7.0-8.5)

  • Solubilization Approaches:

    • Use denaturing conditions (6-8M urea or guanidine HCl) followed by step-wise refolding

    • Test different refolding methods (dialysis, dilution, on-column refolding)

  • Co-expression Strategies:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Co-express with relevant partner proteins that may stabilize COX2

  • Fusion Partner Optimization:

    • Use solubility-enhancing tags (SUMO, MBP, GST)

    • Include flexible linkers between the tag and COX2

Monitoring protein quality throughout the optimization process using techniques like dynamic light scattering and thermal shift assays can provide valuable feedback on aggregation tendencies.

How can wheat COX2 be used in comparative studies with other plant species?

Comparative studies of wheat COX2 with orthologs from other plant species can provide valuable evolutionary and functional insights:

  • Sequence Alignment Analysis:

    • Multiple sequence alignment of COX2 sequences from diverse plant species

    • Identification of conserved functional domains vs. species-specific variations

    • Mapping of conservation patterns onto structural models

  • Functional Comparison:

    • Express and purify COX2 from multiple species using identical systems

    • Compare enzymatic parameters (Km, Vmax, substrate specificity)

    • Assess differential responses to inhibitors or environmental conditions

  • Evolutionary Rate Analysis:

    • Calculate dN/dS ratios to identify regions under selection

    • Correlate sequence variations with adaptation to different environments

    • Map sequence changes onto key functional transitions in plant evolution

This approach can reveal how cytochrome c oxidase function has evolved across plant lineages and identify specific adaptations in wheat mitochondrial function compared to other crops.

What methods are recommended for analyzing the impact of genetic variations in wheat COX2?

To analyze the functional consequences of genetic variations in wheat COX2:

  • Variant Identification:

    • Sequence COX2 from diverse wheat varieties and wild relatives

    • Screen for natural variants using targeted sequencing approaches

    • Use public databases to identify reported polymorphisms

  • Expression and Functional Analysis:

    • Generate recombinant proteins representing major variants

    • Compare enzyme kinetics and stability parameters

    • Assess responses to relevant stressors (temperature, pH, oxidative stress)

  • Molecular Dynamics Simulations:

    • Model the structural impact of key amino acid substitutions

    • Simulate effects on protein dynamics and substrate interactions

    • Predict functional consequences of variants

  • In vivo Validation:

    • Create transgenic plants expressing variant forms

    • Assess phenotypic effects under controlled conditions

    • Measure mitochondrial function in planta

This systematic approach can connect genetic variation in wheat COX2 to functional differences and potentially identify beneficial variants for crop improvement.

What techniques are most effective for studying protein-protein interactions involving wheat COX2?

Several complementary techniques can effectively characterize protein-protein interactions involving wheat COX2:

  • Affinity-Based Methods:

    • Co-immunoprecipitation with tagged recombinant COX2

    • Pull-down assays using purified COX2 as bait

    • Proximity labeling approaches (BioID, APEX) to identify interaction partners in vivo

  • Biophysical Interaction Analysis:

    • Surface plasmon resonance (SPR) for kinetic analysis

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis for solution-based interaction analysis

  • Structural Studies of Complexes:

    • Chemical crosslinking followed by mass spectrometry

    • Hydrogen-deuterium exchange mass spectrometry

    • Cryo-EM of assembled complexes

  • Fluorescence-Based Approaches:

    • Förster resonance energy transfer (FRET) for detecting interactions

    • Fluorescence correlation spectroscopy for dynamic interactions

    • Split-fluorescent protein complementation assays in vivo

These methods can reveal how wheat COX2 interacts with other components of the respiratory chain and with regulatory proteins that modulate its function under different conditions.

How can inhibitor binding studies provide insights into wheat COX2 function?

Inhibitor binding studies can provide valuable insights into COX2 structure and function:

  • Binding Site Identification:

    • Molecular docking simulations to predict binding sites

    • Site-directed mutagenesis of predicted key residues

    • Competition assays with known ligands

  • Structure-Activity Relationship Analysis:

    • Test structurally related compounds to map essential features

    • Measure binding affinity using biophysical methods

    • Correlate structural features with inhibitory potency

  • Functional Impact Assessment:

    • Enzyme inhibition kinetics (competitive, non-competitive, uncompetitive)

    • Effects on protein stability and oligomerization

    • Long-term effects on enzyme activity and turnover

For example, molecular docking studies with Sitophilus zeamais COX2 revealed that allyl isothiocyanate (AITC) could form a 2.9 Å hydrogen bond with Leu-31 . Similar approaches could identify binding sites in wheat COX2 and inform rational design of specific ligands for functional studies.

What are the optimal conditions for maintaining activity of purified wheat COX2 during storage?

To maximize stability and preserve activity of purified wheat COX2:

  • Buffer Composition:

    • Base buffer: 50 mM Tris, pH 7.5-8.0

    • Stabilizing additives: 10-20% glycerol, 150 mM NaCl

    • Potential cofactors: Consider adding 5 μM Hemin for heme-containing proteins

    • Reducing agents: 1-5 mM DTT or 2-10 mM β-mercaptoethanol to prevent oxidation

  • Storage Temperature:

    • Short-term (1-2 weeks): 4°C with protease inhibitors

    • Medium-term (1-6 months): -20°C in buffer with 50% glycerol

    • Long-term (>6 months): -80°C in small aliquots

  • Concentration Considerations:

    • Optimal concentration range: 0.5-2 mg/mL to prevent aggregation

    • For higher concentrations: Consider adding stabilizing agents like sucrose or trehalose

  • Handling Practices:

    • Minimize freeze-thaw cycles by storing in small aliquots

    • Thaw rapidly at room temperature but keep on ice once thawed

    • Centrifuge briefly after thawing to remove any precipitated protein

Following these guidelines can significantly extend the functional lifetime of purified wheat COX2 preparations, ensuring more consistent and reliable experimental results.

How can researchers validate sample integrity before conducting advanced experiments?

Before proceeding with advanced experiments, validate wheat COX2 sample integrity using:

Establishing a routine quality control workflow ensures that experimental outcomes reflect genuine biological properties of wheat COX2 rather than artifacts from sample degradation or contamination.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.