Recombinant Triticum aestivum Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Respiration

COX3 is a critical subunit of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. Its functions include:

  • Electron transfer: Mediates the reduction of oxygen to water via a binuclear center (heme A3 and copper B) .

  • Proton translocation: Couples electron transfer with proton pumping across the mitochondrial inner membrane, contributing to the electrochemical gradient for ATP synthesis .

  • Structural stability: Stabilizes the core complex (subunits I–III) essential for enzymatic activity .

Apoptosis Regulation

  • Overexpression of COX3 in HL-1 cardiomyocytes reduced cytochrome c oxidase activity by 50% and increased caspase-3 cleavage, triggering apoptosis .

  • Mechanism: Disrupted mitochondrial membrane potential and enhanced reactive oxygen species (ROS) production .

Agricultural Applications

  • Wheat protein content: Aegilops tauschii–derived COX3 loci (e.g., qGPCA05.3 and qGPCB05.3) were linked to increased grain protein content (GPC) without compromising yield in recombinant wheat lines .

  • Stress tolerance: COX3 expression correlates with mitochondrial RNA processing under iron and manganese stress, as shown by pentatricopeptide repeat protein interactions .

Applications in Biotechnology

  • Protein interaction studies: Used to map binary interactions with apoptosis regulators (e.g., SNCA, KRAS) via co-immunoprecipitation .

  • Diagnostic tools: Available as an ELISA reagent (1,615.00 €/50 µg) for quantifying COX3 in plant mitochondrial extracts .

  • Mitochondrial marker: Antibodies against COX3 facilitate subcellular localization studies in crops like Cucumis sativus and Arabidopsis thaliana .

Comparative Analysis with Orthologs

FeatureT. aestivum COX3Human MT-CO3
Amino acids265261
Transmembrane domains77
Pathway associationApoptosis, ROS signalingLeber’s optic neuropathy

Challenges and Future Directions

  • Stability issues: Repeated freeze-thaw cycles degrade the protein; glycerol aliquots are recommended for long-term storage .

  • Agricultural engineering: Leveraging COX3-associated QTLs could enhance wheat nutritional profiles under climate stress .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery information, please contact your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Triticum aestivum (Wheat)
Target Names
COX3
Target Protein Sequence
MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHSFQGGATLLSLGLIFILYTMFVW WRDVLRESTLEGHHTKAVQLGLRYGFILFIVSEVMFFFAFFWAFFHSSLAPTVEIGGIWP PKGIGVLDPWEIPLLNTLILLSSGAAVTWAHHAILAGKEKRAVYALVATVLLALVFTGFQ GMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGQMTKKHHVGFEA AAWYWHFVDVVWLFLFVSIYWWGGI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain consists of three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient then powers transmembrane transport and ATP synthase activity. Cytochrome c oxidase plays a crucial role in catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does wheat (Triticum aestivum) COX3 differ structurally from other plant species?

Wheat COX3 shares significant homology with other plant species but contains unique sequence features related to its adaptation in the Triticeae tribe. Research approaches should include comparative genomic analysis of mitochondrial DNA from various species. The complete mitochondrial genome of wheat (such as the maintainer line Km3) contains approximately 34 protein-coding genes including those of the electron transport chain . When analyzing COX3 specifically, researchers should employ sequence alignment tools to identify conserved domains versus wheat-specific regions that may impact protein function or assembly.

What techniques are most effective for isolating and amplifying the COX3 gene from wheat mitochondrial DNA?

Isolation of the COX3 gene requires careful extraction of mitochondrial DNA followed by gene-specific amplification. Based on methodologies for mitochondrial genome analysis in wheat, recommended approaches include:

  • Mitochondrial DNA isolation using differential centrifugation

  • PCR amplification using gene-specific primers

  • Visualization using either:

    • ABI PRISM 3100 Genetic Analyzer for fragment analysis

    • SYBR GREEN protocol with quantitative PCR machine (ABI7900HT) analyzing dissociation curves

For the PCR reaction specifically, a touchdown procedure similar to what was used for wheat genetic mapping is recommended using the following conditions:

  • 0.25 units Taq polymerase

  • 0.5 μM for each primer

  • 1× SYBR Green

  • 0.4 mM for each dNTP

  • 1 M betaine

What are the primary challenges in expressing recombinant wheat COX3 in heterologous systems?

Expression of mitochondrial membrane proteins like COX3 presents several challenges:

  • Codon usage differences between wheat mitochondria and expression systems

  • Hydrophobic transmembrane domains creating folding difficulties

  • Post-translational modifications specific to plant mitochondria

  • Potential toxicity to host cells

To address these challenges, researchers should consider codon optimization, use of specialized expression vectors with mitochondrial targeting sequences, and testing multiple expression systems (bacterial, yeast, insect, and plant-based systems).

How should researchers design experiments to study COX3 function within the context of wheat mitochondrial respiration?

When designing experiments to study COX3 function, consider implementing a quasi-experimental design with appropriate controls . For optimal experimental rigor:

  • Include multiple control groups to account for confounding variables

  • Utilize segmented time-series analysis for respiratory function measurements

  • Employ both in vitro (isolated mitochondria) and in vivo (plant tissue) approaches

Experimental ApproachControl TypeMeasurementsStatistical Analysis
Oxygen consumption assaysWild-type COX3Respiratory ratesTwo-group tests, regression analysis
Electron transport assaysCOX3 knockout/mutantElectron flow ratesSegmented regression analysis
Complex IV assembly analysisCOX3 point mutationsComplex stabilityStandard time-series analysis
ROS production measurementsTissue-specific expressionOxidative stress markersSegmented time-series analysis

Remember to justify your experimental design choice, use correct nomenclature, and acknowledge potential limitations as these were identified as weaknesses in previous research studies .

What controls are essential when comparing native versus recombinant COX3 activity?

When comparing native versus recombinant COX3, essential controls include:

  • Enzyme concentration normalization across samples

  • Temperature and pH controls that mimic physiological conditions

  • Substrate concentration controls

  • Inclusion of detergent-solubilized native COX3 preparations

  • Activity measurements in the presence of specific inhibitors

Analysis should employ statistical methods similar to those used in quasi-experimental studies, such as 2-group statistical tests (43% of studies) or standard regression analysis (34% of studies) as identified in the systematic review of quasi-experimental designs .

What sequencing approaches provide the most comprehensive analysis of COX3 variants across wheat cultivars?

For comprehensive analysis of COX3 variants:

  • Employ complete mitochondrial genome sequencing as demonstrated in comparative studies between wheat lines

  • Use next-generation sequencing with specific enrichment for mitochondrial DNA

  • Implement targeted resequencing of the COX3 locus across diverse wheat germplasm

Analysis should focus on:

  • Single Nucleotide Polymorphisms (SNPs) - similar to the 32 SNPs found in 13 protein-coding genes between Ks3 and Km3 wheat lines

  • Structural variations including possible rearrangements

  • Copy number variations that may affect expression levels

How can researchers accurately quantify COX3 expression levels in different wheat tissues and developmental stages?

For accurate quantification of COX3 expression:

  • RT-qPCR with appropriate reference genes stable across tissues and conditions

  • RNA-Seq with mitochondrial transcript enrichment

  • Protein-level quantification via western blot with COX3-specific antibodies

  • Blue-native PAGE for complex assembly analysis

MethodAdvantagesLimitationsData Normalization
RT-qPCRHigh sensitivity, tissue-specificRequires stable reference genesMultiple reference genes approach
RNA-SeqGenome-wide context, isoformsBioinformatic complexityTPM/FPKM and mitochondrial reads
Western blotProtein-level validationAntibody specificity issuesTotal protein normalization
BN-PAGEComplex assembly visualizationSemi-quantitativeDensitometry with standards

How should researchers interpret contradictory results when analyzing COX3 function across different wheat varieties?

When facing contradictory results:

  • Examine mitochondrial genome differences between varieties - research shows extensive variation in wheat mitochondrial genomes (with Ks3-specific mtDNA representing 11.38% of the total and containing 29 unique repeats)

  • Consider the effect of nuclear background on mitochondrial gene expression

  • Evaluate experimental conditions that may affect COX3 function

  • Assess methods used for functional measurements

Approach contradictions systematically by creating a data matrix that compares:

  • Genetic background of each variety

  • Environmental conditions during growth

  • Methods used for functional assessment

  • Statistical approaches employed

What statistical approaches are most appropriate for analyzing variability in COX3 activity data?

Based on systematic review of quasi-experimental studies, appropriate statistical approaches include:

  • Standard regression analysis (used in 34% of studies)

  • Segmented regression analysis (10% of studies) - especially valuable for time-course experiments

  • Time-series analysis (4% of studies) - for longitudinal studies of COX3 activity

  • Segmented time-series analysis (3% of studies) - for intervention studies

For multivariate data, consider principal component analysis to identify patterns across multiple variables affecting COX3 function.

How can site-directed mutagenesis of recombinant COX3 elucidate structure-function relationships?

Site-directed mutagenesis approach should:

  • Target conserved residues identified through multi-species alignment

  • Focus on transmembrane domains that interact with other complex IV subunits

  • Modify potential post-translational modification sites

Create systematic mutation libraries targeting:

Domain TypeResidue Selection StrategyFunctional Assessment
TransmembraneConserved hydrophobic residuesAssembly analysis, activity assays
Intermembrane loopsCharged residuesProtein-protein interaction studies
Matrix-facing regionsCatalytic residuesElectron transfer efficiency
Interface regionsResidues contacting other subunitsComplex stability measurements

Analysis should incorporate molecular dynamics simulations to predict structural impacts before experimental validation.

What approaches can detect and characterize post-translational modifications of wheat COX3?

To characterize post-translational modifications:

  • Mass spectrometry-based proteomics with:

    • Enrichment protocols for modified peptides

    • Multiple fragmentation techniques (CID, ETD, HCD)

    • Label-free quantification of modification stoichiometry

  • Site-specific antibodies against known modifications

  • Functional studies comparing wild-type versus modification-deficient mutants

Processing and analysis should employ specialized proteomics software with mitochondrial protein databases as reference.

How does environmental stress affect COX3 expression and function in wheat?

Studying environmental stress effects requires:

  • Controlled stress experiments (temperature, drought, salinity)

  • Time-course sampling to capture dynamic responses

  • Multi-omics approach integrating:

    • Transcriptomics of COX3 expression

    • Proteomics of complex IV composition

    • Metabolomics of respiratory intermediates

    • Phenotypic measurements of respiratory function

Analysis should utilize quasi-experimental designs with appropriate controls as outlined in methodological reviews . Segmented time-series analysis is particularly valuable for capturing changes before, during, and after stress exposure.

How can recombinant COX3 studies inform cytoplasmic male sterility (CMS) research in wheat breeding?

CMS systems in wheat are frequently associated with mitochondrial genome rearrangements. Research approaches should:

  • Compare COX3 sequences and expression between maintainer lines (like Km3) and CMS lines (like Ks3)

  • Analyze potential interactions between COX3 and unique ORFs found in CMS lines

  • Investigate COX3 complex assembly differences between fertile and sterile lines

The comparative mitochondrial genome analysis between wheat K-type CMS line Ks3 and maintainer line Km3 revealed significant differences in non-coding sequences and the creation of novel chimeric ORFs that may be candidate genes for CMS . Similar approaches should be applied specifically to COX3 to understand its potential role in fertility.

What techniques can effectively track COX3 sequence inheritance in wheat crossing experiments?

For tracking COX3 inheritance:

  • Develop COX3-specific molecular markers:

    • SNP markers for variety-specific polymorphisms

    • PCR-based markers targeting sequence variations

    • RFLP markers for structural variations

  • Implement high-throughput genotyping approaches:

    • KASP assays for SNP detection

    • Next-generation sequencing for multiplexed analysis

    • Digital PCR for copy number assessment

Similar methodologies to those used in recombination studies along wheat chromosomes can be adapted, utilizing PCR conditions with visualization via ABI PRISM 3100 Genetic Analyzer or SYBR GREEN protocol with quantitative PCR machine .

The data should be analyzed using genetic mapping approaches, comparing inheritance patterns to expected maternal transmission typical of mitochondrial genes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.