Recombinant Triticum aestivum NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Triticum aestivum (Wheat)
Target Names
ND3
Target Protein Sequence
MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be its immediate electron acceptor.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 3 in Triticum aestivum?

NADH-ubiquinone oxidoreductase chain 3 (ND3) in Triticum aestivum (wheat) is a mitochondrial protein component of Complex I in the electron transport chain. It functions as part of the enzyme classified as EC 1.6.5.3 and is also known as NADH dehydrogenase subunit 3. The protein is encoded by the NAD3 gene in the mitochondrial genome. ND3 plays a critical role in cellular respiration, facilitating electron transfer from NADH to ubiquinone and contributing to the proton gradient used for ATP synthesis .

How is recombinant Triticum aestivum ND3 typically expressed and purified for research purposes?

Recombinant Triticum aestivum ND3 can be expressed using several expression systems, with bacterial systems being most common for initial studies. For expression, the ND3 coding sequence is typically cloned into an expression vector containing an appropriate promoter and a tag sequence (such as His-tag or GST) to facilitate purification.

For purification, the following general methodology is employed:

  • Cell lysis using appropriate buffers containing mild detergents

  • Initial purification using affinity chromatography based on the fusion tag

  • Secondary purification using ion exchange or size exclusion chromatography

  • Quality assessment using SDS-PAGE and Western blotting

  • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

Researchers should note that the specific tag type may be determined during the production process based on protein characteristics, and repeated freeze-thaw cycles should be avoided to maintain protein integrity .

What are the main challenges in working with recombinant ND3 from wheat compared to other plant species?

Working with recombinant ND3 from wheat presents several unique challenges:

  • Codon optimization issues: Wheat genes often contain codons that are less efficiently expressed in standard bacterial systems, necessitating codon optimization.

  • Protein folding challenges: As a membrane protein with multiple transmembrane domains, ND3 may encounter folding difficulties in heterologous expression systems.

  • Polyploidy complexities: Wheat's hexaploid nature means multiple homeologous copies of ND3 may exist, requiring careful sequence verification to ensure the correct variant is being studied.

  • Post-translational modifications: Any wheat-specific modifications may be absent in recombinant systems, potentially affecting protein function.

  • Solubility limitations: The hydrophobic nature of ND3 often necessitates specialized detergents or membrane mimetics for solubilization and functional studies.

Researchers typically address these challenges through codon optimization, expression system selection, and the addition of solubility-enhancing tags or fusion partners.

How can gene editing techniques be optimized for studying ND3 function in wheat?

Optimizing gene editing techniques for studying ND3 function in wheat requires a multifaceted approach:

  • CRISPR-Cas9 design strategy:

    • Target conserved regions of ND3 to affect all homeologous copies simultaneously

    • Alternatively, design genome-specific gRNAs to target individual homeologs

    • Select PAM sites that minimize off-target effects

  • Delivery methods:

    • Agrobacterium-mediated transformation for stable integration

    • Biolistic bombardment for transient expression or difficult genotypes

    • Protoplast transformation for initial validation studies

  • Verification protocols:

    • Develop PCR-based screening methods with primers flanking the target site

    • Sequence verification of edited regions

    • Transcript analysis to confirm expression changes

  • Phenotypic analysis:

    • Assess respiratory chain function using oxygen consumption measurements

    • Analyze ATP synthesis rates

    • Measure ROS production and oxidative stress markers

This approach is similar to methods used in other wheat gene editing studies, such as those employed in wheat-Dasypyrum villosum translocation lines where targeted modifications were confirmed through molecular markers and functional analysis .

What are the current methods for investigating interactions between ND3 and other components of the respiratory complex in wheat?

Current methods for investigating ND3 interactions with other respiratory complex components include:

  • Co-immunoprecipitation (Co-IP):

    • Using antibodies against epitope-tagged ND3 to pull down interacting partners

    • Mass spectrometry analysis of the immunoprecipitated complex

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • Separation of intact respiratory complexes under native conditions

    • Western blotting with antibodies against ND3 and potential interacting partners

  • Proximity Labeling Techniques:

    • BioID or APEX2 fusion proteins to identify proximal proteins in vivo

    • Analysis of labeled proteins by mass spectrometry

  • Cryo-electron microscopy:

    • Structural analysis of purified respiratory complexes

    • Visualization of ND3 positioning within Complex I

  • Crosslinking Mass Spectrometry (XL-MS):

    • Chemical crosslinking of interacting proteins

    • Mass spectrometry identification of crosslinked peptides to map interaction interfaces

These methods have been adapted from studies of Complex I in other organisms and modified for the specific challenges of working with plant mitochondrial proteins.

What are the recommended protocols for studying the role of ND3 in oxidative stress response in wheat?

For studying ND3's role in oxidative stress response in wheat, the following methodological approach is recommended:

  • Generation of experimental materials:

    • Develop transgenic wheat lines with altered ND3 expression (overexpression, RNAi knockdown, or CRISPR-edited variants)

    • Establish appropriate wild-type controls

    • Treat plants with oxidative stress inducers (e.g., methyl viologen, hydrogen peroxide, salt stress, drought)

  • Physiological measurements:

    • Measure photosynthetic parameters (Fv/Fm, ΦPSII) using chlorophyll fluorescence

    • Assess respiratory rates using oxygen electrodes

    • Quantify biomass accumulation and growth parameters

  • Biochemical analyses:

    • ROS detection using fluorescent probes (DCF-DA, DHE)

    • Antioxidant enzyme activity assays (SOD, CAT, APX, GR)

    • Lipid peroxidation measurement (MDA content)

  • Molecular analyses:

    • Transcript analysis of stress-responsive genes

    • Proteomics analysis focusing on mitochondrial proteins

    • Post-translational modification analysis (carbonylation, nitrosylation)

  • Data integration:

    • Correlate changes in ND3 function with oxidative stress markers

    • Compare results across different stress conditions

    • Develop models explaining ND3's role in stress response

This approach integrates multiple levels of analysis to establish the relationship between ND3 function and oxidative stress tolerance in wheat.

How can researchers optimize expression systems for producing functional recombinant ND3 protein?

Optimizing expression systems for functional recombinant ND3 production requires addressing several critical factors:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coliCost-effective, rapid growth, high yieldMembrane protein folding issues, lack of PTMsUse specialized strains (C41, C43), fusion tags, low induction temperature
Yeast (S. cerevisiae, P. pastoris)Eukaryotic PTMs, better membrane protein foldingLower yields, longer growth timesCodon optimization, inducible promoters, optimized growth media
Insect cellsGood for complex proteins, near-native foldingHigher cost, technical complexityBaculovirus optimization, cell line selection, timing of harvest
Plant expression systemsNative environment, proper PTMsLower yields, time-consumingTransient expression, viral vectors, subcellular targeting

Additional optimization strategies include:

  • Vector design:

    • Use strong but controllable promoters

    • Include fusion partners that enhance solubility (MBP, SUMO, etc.)

    • Incorporate cleavable tags for purification

  • Expression conditions:

    • Test various induction parameters (temperature, inducer concentration, time)

    • Optimize media composition and growth conditions

    • Add membrane-mimetic compounds for stability

  • Purification approach:

    • Select detergents appropriate for membrane protein extraction

    • Use affinity chromatography followed by size exclusion

    • Verify protein folding using circular dichroism or fluorescence spectroscopy

These strategies can be tailored based on the specific research requirements and downstream applications of the recombinant ND3 protein.

What are the best practices for analyzing ND3 mutations and their impact on wheat mitochondrial function?

Analyzing ND3 mutations and their impact on wheat mitochondrial function should follow these best practices:

  • Mutation characterization:

    • Conduct thorough sequencing to confirm the exact nature of the mutation

    • Use predictive algorithms to assess potential functional consequences

    • Model structural changes using available Complex I structures from related species

  • Functional assays:

    • Measure Complex I activity using spectrophotometric NADH oxidation assays

    • Assess electron transfer efficiency through artificial electron acceptors

    • Quantify proton pumping efficiency using pH-sensitive probes

  • Whole-cell energetics assessment:

    • Analyze respiration rates in isolated mitochondria

    • Measure membrane potential using fluorescent dyes (e.g., JC-1, TMRM)

    • Quantify ATP production rates using luminescence-based assays

  • Comparative analysis:

    • Compare mutant phenotypes to wild-type and known Complex I mutants

    • Evaluate phenotypes across different developmental stages and tissues

    • Assess environmental condition interactions with the mutation

  • Data integration framework:

    • Correlate molecular data with physiological phenotypes

    • Use statistical methods appropriate for multi-level data (ANOVA, PCA, etc.)

    • Consider systems biology approaches to model effects on whole-plant metabolism

How should researchers interpret contradictory results in ND3 functional studies across different wheat varieties?

When faced with contradictory results in ND3 functional studies across different wheat varieties, researchers should employ the following interpretative framework:

  • Genetic background assessment:

    • Examine differences in nuclear and mitochondrial genomes between varieties

    • Consider homeolog-specific expression patterns in different genetic backgrounds

    • Evaluate potential compensatory mechanisms in different varieties

  • Methodological evaluation:

    • Compare experimental conditions, including growth parameters and tissue types

    • Assess differences in protein extraction and analysis techniques

    • Consider timing of sampling and developmental stages

  • Statistical rigor:

    • Ensure adequate biological and technical replication

    • Apply appropriate statistical tests with consideration of data distribution

    • Calculate effect sizes to compare magnitude of differences between studies

  • Environmental interactions:

    • Analyze genotype × environment interactions

    • Consider photoperiod, temperature, and other conditions that may influence results

    • Evaluate stress responses that might differentially affect ND3 function

  • Resolution strategies:

    • Design experiments that directly compare varieties under identical conditions

    • Use reciprocal crossing to assess nuclear-mitochondrial interactions

    • Develop isogenic lines differing only in the ND3 region

This approach recognizes that contradictory results often reflect biological complexity rather than experimental error, particularly in a complex polyploid like wheat with multiple homeologous genes and variety-specific adaptations.

What are the promising areas for investigating ND3's role in wheat adaptation to environmental stresses?

Several promising research areas for investigating ND3's role in wheat adaptation to environmental stresses include:

  • Climate change resilience:

    • Study ND3 variants in wheat varieties adapted to different climatic conditions

    • Investigate how ND3 function responds to combined heat and drought stress

    • Examine respiratory efficiency under projected future climate scenarios

  • Stress-specific responses:

    • Characterize ND3 post-translational modifications under various stress conditions

    • Investigate differential interaction networks of ND3 during stress adaptation

    • Explore the role of ND3 in ROS signaling during stress response

  • Integration with hormone signaling:

    • Study cross-talk between ND3 function and abscisic acid (ABA) signaling pathways

    • Investigate how jasmonic acid affects mitochondrial function through ND3

    • Examine potential interactions with ethylene biosynthesis during stress

  • Comparative evolutionary studies:

    • Compare ND3 sequences and functions across wheat relatives with varying stress tolerance

    • Investigate unique features of ND3 in stress-adapted wild relatives

    • Consider how domestication has affected ND3 function in modern wheat varieties

  • Systems biology integration:

    • Develop models predicting how ND3 variations affect whole-plant energy balance

    • Integrate transcriptomic, proteomic, and metabolomic data to understand ND3's broader role

    • Utilize network analysis to identify key interactions in stress adaptation pathways

These research directions build upon existing knowledge of plant mitochondrial function while leveraging new technologies and approaches to understand ND3's specific contributions to stress adaptation in wheat.

How might emerging technologies advance our understanding of ND3 structure-function relationships in wheat?

Emerging technologies offer significant potential to advance our understanding of ND3 structure-function relationships in wheat:

  • Cryo-electron microscopy advancements:

    • High-resolution structures of plant-specific Complex I configurations

    • Visualization of wheat-specific features of ND3 and its interactions

    • Dynamic studies of conformational changes during electron transport

  • Single-molecule techniques:

    • FRET studies to measure conformational changes in ND3 during catalysis

    • Single-molecule force spectroscopy to assess protein stability and unfolding

    • Nanopore analysis for studying membrane protein insertion and topology

  • Genome editing technologies:

    • Prime editing for precise nucleotide changes in mitochondrial genes

    • Base editing approaches for creating specific ND3 variants

    • CRISPR interference for temporary and reversible functional studies

  • Synthetic biology approaches:

    • Reconstitution of minimal functional units containing ND3

    • Designer Complex I assemblies with modified ND3 components

    • Development of semi-synthetic organelles for isolating ND3 functions

  • Computational advances:

    • Molecular dynamics simulations of ND3 in membrane environments

    • Machine learning approaches to predict functional consequences of ND3 variations

    • Quantum mechanical calculations of electron transfer through Complex I

These technologies promise to bridge current knowledge gaps by providing unprecedented insights into the molecular mechanisms of ND3 function, potentially leading to engineered improvements in wheat energy metabolism and stress tolerance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.