Recombinant Triticum aestivum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant CP47 is typically produced in E. coli using codon-optimized sequences fused with affinity tags (e.g., His-tag) for purification. Key steps include:

  • Cloning: The psbB gene is inserted into expression vectors under strong promoters (e.g., T7) .

  • Expression: Induced in E. coli at low temperatures (16–20°C) to enhance solubility .

  • Purification: Nickel-affinity chromatography followed by ion-exchange chromatography .

Example Purification Metrics (Spinach CP47)

ParameterValue
Purity>90% (SDS-PAGE)
StorageLyophilized at -80°C in Tris/PBS buffer
Yield0.1–1.0 mg/mL after reconstitution

Challenges include protein aggregation and improper chlorophyll integration, as observed in analogous systems .

Stability Determinants

  • The 5' untranslated region (UTR) of psbB mRNA is critical for transcript stability and translation efficiency .

  • Deletion of stem-loop structures in the 5' UTR reduces mRNA accumulation in Chlamydomonas reinhardtii .

Assembly Defects

  • Knockout of assembly factors (e.g., PsbN) disrupts CP47 integration into PSII, reducing PSII activity by ~75% .

  • Mutants lacking Psb34 show impaired CP47 folding and chlorophyll binding .

Comparative Analysis Across Species

CP47 exhibits high sequence conservation among plants, but recombinant expression efficiency varies:

SpeciesExpression SystemKey Findings
Spinacia oleraceaE. coliFull-length protein achieved with His-tag; used for antibody production
Populus albaE. coliStructural studies reveal conserved chlorophyll-binding motifs
Triticum aestivumInferred from homologsPsbB expression correlates with leaf color phenotypes in mutants

Applications in Photosynthesis Research

Recombinant CP47 is utilized to:

  • Study PSII assembly mechanisms .

  • Engineer drought-resistant crops by enhancing PSII stability .

  • Develop antibodies for diagnostic tools (e.g., PhytoAB’s anti-CP47 antibody) .

Challenges and Future Directions

  • Heterologous Expression: Chlorophyll integration remains inefficient in bacterial systems .

  • Structural Biology: Cryo-EM studies of T. aestivum CP47 are needed to resolve species-specific assembly pathways .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we have in stock, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Triticum aestivum (Wheat)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITDSWGGWSISGGTVTNPGIWSYEGVAGTHIVFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSNGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRKQAA
Uniprot No.

Target Background

Function
CP47, a component of the core complex of photosystem II (PSII), plays a crucial role in binding chlorophyll and facilitating the primary light-induced photochemical processes of PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient, subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem II CP47 chlorophyll apoprotein and what is its role in photosynthesis?

Photosystem II CP47 chlorophyll apoprotein (psbB) is a 47 kDa protein found in the thylakoid membranes of plants, including wheat (Triticum aestivum). It functions as an integral component of the core antenna system within Photosystem II (PSII). The protein binds multiple chlorophyll a molecules and serves as an inner light-harvesting antenna, capturing photons and transferring excitation energy to the PSII reaction center. The full amino acid sequence contains 508 amino acids with multiple transmembrane domains that anchor the protein within the thylakoid membrane .

CP47 plays a crucial role in the organization of the PSII supercomplex, maintaining structural integrity and facilitating efficient energy transfer. Within the photosynthetic apparatus, CP47 works in concert with other core proteins such as CP43, D1, and D2 to enable light harvesting and subsequent electron transport reactions. Its function is essential for maintaining optimal photosynthetic efficiency, particularly under varying environmental conditions .

What are the optimal storage conditions for recombinant psbB protein?

For working solutions, aliquots should be stored at 4°C for up to one week to minimize degradation. When preparing the protein for experimental use, it is advisable to centrifuge the vial briefly before opening to ensure all material is at the bottom of the container. Reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

For long-term storage, adding glycerol to a final concentration of 5-50% and creating multiple small aliquots is recommended to avoid repeated freeze-thaw cycles. This approach minimizes protein degradation and maintains structural integrity for downstream applications .

How can chlorophyll fluorescence techniques be used to study PSII CP47 functionality?

Chlorophyll fluorescence analysis provides a powerful non-invasive approach for investigating PSII CP47 functionality in intact systems. The method employs modulated imaging fluorometers such as the Imaging PAM M-Series to measure various parameters that reflect photosystem performance. To obtain accurate measurements, samples should first be dark-adapted for approximately 1 hour to ensure all PSII reaction centers are in an open state .

Key parameters that can be measured include:

The measurement protocol typically involves applying a saturation pulse intensity of 8,000 μmol m^-2 s^-1 and an actinic light intensity of 150 μmol m^-2 s^-1. For more detailed analysis, OJIP transients can be measured after dark adaptation by exposing samples to a saturated pulse intensity of 5,000 μmol photons m^-2 s^-1 for 0.5 seconds .

These fluorescence techniques can be particularly valuable when assessing how environmental stresses affect CP47 functionality or when evaluating the effects of site-directed mutagenesis on protein performance.

What molecular techniques are most effective for studying CP47 protein interactions within thylakoid membranes?

Blue native-polyacrylamide gel electrophoresis (BN-PAGE) represents one of the most effective techniques for investigating CP47 protein interactions within thylakoid membrane complexes. This approach allows for the separation and analysis of intact membrane protein complexes under native conditions, providing insights into how CP47 associates with other PSII components .

The BN-PAGE protocol for studying CP47 interactions typically involves:

  • Isolation of thylakoid membranes from plant tissue, with samples stored at -80°C

  • Solubilization of membrane proteins using 1% (w/v) n-dodecyl-β-D-maltoside in the dark for 10 minutes on ice

  • Separation on a gradient gel of 5-12.5% acrylamide, using a gradual increase in voltage (75-200 V) for 3-4 hours at 4°C

  • For second-dimensional analysis, BN-PAGE strips are incubated in Laemmli buffer containing 2-mercaptoethanol (5%, v/v) for 1 hour at room temperature prior to SDS-PAGE

  • Visualization through Coomassie Brilliant Blue R staining or immunoblotting with specific antibodies against CP47

This technique can be complemented with mass spectrometry analysis for protein identification and characterization of post-translational modifications such as phosphorylation states. Co-immunoprecipitation experiments using antibodies against CP47 can also provide valuable information about protein-protein interactions within the thylakoid membrane environment .

How does the stabilization of CP47 apoprotein compare to other PSII proteins?

The stabilization of CP47 apoprotein exhibits distinct characteristics compared to other PSII proteins such as CP43, D1, D2, and P700. Research using in vitro synthesis of chlorophyll a or Zn-pheophytin a in intact etioplasts from barley has demonstrated that the stabilization efficiency varies significantly among these proteins .

Zn-pheophytin a has been shown to be superior to chlorophyll a for stabilizing CP47 and other chlorophyll a-binding proteins. Specifically, CP47 exhibits the highest stabilization efficiency with Zn-pheophytin a compared to other PSII proteins. The concentration of pigment required for equivalent stabilization is lower for Zn-pheophytin a than for chlorophyll a, making it more efficient for experimental applications .

The stabilization profile follows this general pattern:

ProteinRelative Stabilization Efficiency with Zn-pheophytin aOptimal Pigment Concentration Range
CP47HighestLower concentration range
CP43ModerateIncreased concentration required
P700ModerateIncreased concentration required
D1ModerateIncreased concentration required
D2LowerHigher concentration range

For optimal results, stabilization of apoproteins is highest after de novo synthesis of 90-300 pmol of Zn-pheophytin a or about 400-600 pmol of chlorophyll a per 4.2 × 10^7 etioplasts. Interestingly, higher concentrations of Zn-pheophytin a can actually reduce the yield of stabilized chlorophyll proteins, while higher concentrations of chlorophyll a do not show this inhibitory effect .

What protocols are recommended for extraction and purification of recombinant CP47?

The extraction and purification of recombinant Triticum aestivum Photosystem II CP47 chlorophyll apoprotein requires careful handling to maintain protein integrity and functionality. Based on established procedures for similar membrane proteins, the following protocol is recommended:

  • Cell Lysis and Initial Extraction:

    • Harvest E. coli cells expressing the recombinant protein by centrifugation

    • Resuspend cell pellet in ice-cold lysis buffer (typically Tris-based, pH 8.0)

    • Disrupt cells using sonication or French press

    • Add appropriate detergents (such as n-dodecyl-β-D-maltoside) to solubilize membrane proteins

  • Affinity Chromatography:

    • For His-tagged recombinant CP47, use nickel or cobalt affinity resins

    • Equilibrate column with binding buffer containing low imidazole concentration

    • Apply clarified lysate to the column

    • Wash with increasing imidazole concentrations to remove non-specific binding

    • Elute purified protein with high imidazole concentration buffer

  • Additional Purification Steps:

    • Size exclusion chromatography to separate monomers from aggregates

    • Ion exchange chromatography for further purification if needed

  • Buffer Exchange and Concentration:

    • Exchange into final storage buffer (Tris-based buffer with 50% glycerol)

    • Concentrate using centrifugal filter devices with appropriate molecular weight cutoff

  • Quality Control:

    • Assess purity by SDS-PAGE and Western blotting

    • Verify functionality through chlorophyll binding assays

    • Confirm protein identity through mass spectrometry

Throughout the purification process, it is critical to maintain the protein at 4°C and minimize exposure to light to prevent degradation. For long-term storage, aliquoting the purified protein and storing at -20°C or -80°C is recommended, with the addition of glycerol to prevent freeze-thaw damage .

How can phosphorylation states of CP47 be analyzed under different light conditions?

The analysis of CP47 phosphorylation states under various light conditions provides valuable insights into regulatory mechanisms of PSII function. To effectively study these post-translational modifications, the following methodological approach is recommended:

  • Induction of Different Phosphorylation States:

    • Expose plant samples to high light intensity (1,000 μmol photons m^-2 s^-1) for 60 minutes to induce phosphorylation of PSII reaction center proteins

    • Alternatively, use moderate light intensity (80 μmol photons m^-2 s^-1) for 60 minutes to induce maximum LHCII phosphorylation

    • For dephosphorylation studies, transfer light-treated samples to darkness for 120 minutes

  • Thylakoid Membrane Isolation:

    • Harvest and flash-freeze plant tissue in liquid nitrogen at specific time points

    • Extract thylakoid membranes according to established protocols

    • Store isolated membranes at -80°C until analysis

  • Protein Separation and Detection:

    • Separate thylakoid proteins using SDS-PAGE with 15% acrylamide and 6M urea

    • For detection of phosphorylated proteins, use:
      a) Phospho-specific antibodies against CP47 phosphorylation sites
      b) Pro-Q Diamond phosphoprotein stain followed by SYPRO Ruby protein stain
      c) Phos-tag acrylamide gels for enhanced separation of phosphorylated proteins

  • Mass Spectrometry Analysis:

    • Perform in-gel digestion of CP47 protein bands

    • Analyze peptides using liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Identify specific phosphorylation sites and quantify relative phosphorylation levels

  • Data Analysis:

    • Compare phosphorylation patterns across different light treatments

    • Correlate phosphorylation status with changes in photosynthetic parameters measured by chlorophyll fluorescence

This integrated approach allows researchers to establish relationships between environmental conditions, CP47 phosphorylation states, and PSII functionality, providing insights into regulatory mechanisms of photosynthesis under changing light environments.

What spectroscopic methods are effective for studying CP47 chlorophyll binding properties?

Multiple spectroscopic techniques can be employed to investigate the chlorophyll binding properties of CP47, each providing unique and complementary information about pigment-protein interactions:

  • Absorption Spectroscopy:

    • Measure absorption spectra using UV-Vis spectrophotometer with mounted integrating sphere

    • Compare spectra before and after reconstitution with chlorophyll

    • Identify characteristic absorption peaks for chlorophyll a bound to CP47

    • Quantify pigment binding through difference spectra analysis

  • Fluorescence Spectroscopy:

    • Measure steady-state fluorescence emission spectra at room temperature and at 77K

    • Analyze excitation spectra to determine energy transfer pathways

    • Use time-resolved fluorescence to investigate energy transfer kinetics

    • Combine with computational modeling to interpret energy transfer networks

  • Circular Dichroism (CD) Spectroscopy:

    • Analyze CD spectra in visible and near-UV regions

    • Determine pigment-pigment interactions within the protein environment

    • Assess changes in protein secondary structure upon pigment binding

  • Resonance Raman Spectroscopy:

    • Identify vibrational modes associated with chlorophyll-protein interactions

    • Distinguish between different chlorophyll molecules within the protein

    • Determine the local environment of individual chlorophyll molecules

  • Comparative Analysis Framework:

Spectroscopic MethodInformation ProvidedSample RequirementsAdvantagesLimitations
AbsorptionPigment content and types~20 μg proteinQuantitative, simpleLimited structural information
FluorescenceEnergy transfer pathways~10 μg proteinHigh sensitivity, dynamic informationComplex interpretation
Circular DichroismPigment organization~50 μg proteinConfiguration informationRequires high sample purity
Resonance RamanLocal environment~100 μg proteinSite-specific informationComplex sample preparation

When combined with site-directed mutagenesis of potential chlorophyll-binding residues, these spectroscopic approaches provide powerful tools for understanding the structural basis of CP47 function in light harvesting and energy transfer within Photosystem II .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.