Recombinant Triticum aestivum Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Identity

The Recombinant Triticum aestivum Photosystem Q (B) protein (UniProt ID: P12463) is a 344-amino acid polypeptide expressed in E. coli with an N-terminal His tag for purification . It is synonymous with the 32 kDa thylakoid membrane protein or Photosystem II D1 protein, encoded by the psbA gene . This recombinant form retains structural and functional fidelity to its native counterpart, enabling studies on photosynthesis and stress responses.

Functional Roles in Photosynthesis

  • Electron Transport: Binds plastoquinone (Q<sub>B</sub>), mediating electron transfer from QA to QB in PSII .

  • Stress Response Modulation: Downregulation under specific stress conditions correlates with reduced photosynthetic activity .

  • Structural Stability: Integral to the PSII reaction center, maintaining chlorophyll-protein interactions .

Table 2: Key Experimental Observations

Condition/StudyFindingsSource
Proteomic Stress AnalysisDownregulated under pH 4.7–5.0 conditions, indicating sensitivity to acidic stress .
Transgenic Plant StudiesEnhanced PSII activity observed in Arabidopsis overexpressing related kinases .
Structural AnalysisPredicted transmembrane domains critical for plastoquinone binding .

Applications in Research

  • Biochemical Assays: Used in SDS-PAGE and ELISA for protein interaction studies .

  • Stress Response Modeling: Serves as a marker for evaluating photosynthetic efficiency under abiotic stress .

  • Antibody Production: Utilized as an antigen for developing PSII-specific antibodies .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, should you have a specific format preference, kindly indicate your requirement when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Our proteins are routinely shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. An additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening to concentrate the contents at the bottom. Please reconstitute the protein using deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point for your preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specification.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; 32 kDa thylakoid membrane protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Triticum aestivum (Wheat)
Target Names
psbA
Target Protein Sequence
TAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently used for ATP formation. It consists of a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Triticum aestivum Photosystem Q(B) protein and what is its function in wheat?

Triticum aestivum Photosystem Q(B) protein, also known as Photosystem II protein D1 or PSII D1 protein, is a crucial 32 kDa thylakoid membrane protein involved in photosynthesis in wheat. It functions as a key component of the photosynthetic machinery . The protein is encoded by the psbA gene and plays an essential role in the electron transport chain within Photosystem II . It forms part of the reaction center of PSII and is involved in the binding of plastoquinone, which is critical for electron transfer during the light-dependent reactions of photosynthesis .

How does the recombinant form of Triticum aestivum Photosystem Q(B) protein differ from the native protein?

The recombinant form of Triticum aestivum Photosystem Q(B) protein is typically produced with modifications to facilitate purification and experimental manipulation. Key differences include:

  • Addition of affinity tags: Most commercially available recombinant forms contain an N-terminal His-tag to facilitate purification using metal affinity chromatography .

  • Expression system: The recombinant protein is commonly expressed in E. coli rather than in plant cells, which may affect post-translational modifications .

  • Storage form: While native protein exists embedded in thylakoid membranes, recombinant versions are often supplied as lyophilized powder that requires reconstitution .

  • Buffer conditions: Recombinant proteins are typically stored in specific buffer systems (e.g., Tris/PBS-based buffer with trehalose) to maintain stability during storage and shipping .

These modifications enable research applications while maintaining the core structural features necessary for studying protein function.

What are the optimal conditions for reconstitution and storage of recombinant Photosystem Q(B) protein?

For optimal reconstitution and storage of recombinant Triticum aestivum Photosystem Q(B) protein, researchers should follow these evidence-based protocols:

Reconstitution Protocol:

  • Briefly centrifuge the vial containing lyophilized protein before opening to bring contents to the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) to prevent freeze-thaw damage .

Storage Recommendations:

  • Store the reconstituted protein at -20°C/-80°C in single-use aliquots to avoid repeated freeze-thaw cycles.

  • For short-term use, working aliquots can be stored at 4°C for up to one week.

  • The reconstituted protein is typically stable in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided to maintain experimental reproducibility.

What analytical techniques are most effective for studying Photosystem Q(B) protein function in vitro?

Multiple analytical techniques have proven effective for investigating Photosystem Q(B) protein function, each addressing different aspects of its biochemistry and biophysics:

These techniques are most informative when used in combination, providing complementary data on both structural and functional aspects of the protein.

How can RNA interference be used to study Photosystem Q(B) protein function in planta?

RNA interference (RNAi) has proven to be a valuable tool for studying Photosystem Q(B) protein function in plants, as demonstrated by research in Arabidopsis. A methodological approach includes:

  • Target Selection and RNAi Construct Design:

    • Identify specific gene sequences (e.g., psbA) that encode the Photosystem Q(B) protein.

    • Design RNAi constructs that can simultaneously suppress multiple gene family members if necessary.

    • In Arabidopsis studies, researchers simultaneously suppressed two genes encoding PsbQ proteins: psbQ-1 (At4g21280) and psbQ-2 (At4g05180) .

  • Plant Transformation and Validation:

    • Transform plants using Agrobacterium-mediated methods.

    • Confirm successful gene suppression through:

      • Western blot analysis to verify reduced protein levels

      • RT-PCR to confirm decreased transcript abundance

    • Generate and characterize multiple independent transgenic lines to control for positional effects .

  • Phenotypic Characterization:

    • Compare wild-type and RNAi plants under various light conditions, as phenotypic differences may only manifest under specific conditions (e.g., low light).

    • Assess visual phenotypes, growth rates, and developmental progression .

  • Functional Analysis:

    • Measure photosynthetic parameters using techniques such as:

      • Oxygen evolution analysis

      • Chlorophyll fluorescence measurements

      • Flash oxygen yield analysis on isolated thylakoid membranes

    • Determine stability of photosynthetic complexes through biochemical assays .

Studies in Arabidopsis demonstrated that PsbQ-deficient plants showed significant changes in Photosystem II function, particularly under low light conditions, despite appearing visually normal under standard growth conditions . This highlights the importance of testing multiple environmental conditions when characterizing RNAi plants.

How does protein turnover affect Photosystem Q(B) protein abundance during wheat grain development?

Protein turnover plays a crucial role in determining Photosystem Q(B) protein abundance during wheat grain development. Recent research combining in vivo stable isotope labeling with quantitative proteomics has revealed several key insights:

  • Spatiotemporal Patterns of Turnover:

    • Photosynthetic proteins, including Photosystem components, display distinct turnover patterns during grain development.

    • Turnover rates explain variations in protein abundance that cannot be attributed solely to gene expression differences .

  • Metabolic Investment:

    • Approximately 20% of total grain ATP production is dedicated to proteome biogenesis and maintenance.

    • This significant energy investment highlights the importance of protein quality control in developing grains .

  • Stability Metrics:

    • Photosystem proteins show differential stability during grain development.

    • In comprehensive studies of 1,400 different proteins in developing wheat grains, photosynthetic apparatus components were identified among both the most stable and least stable proteins .

  • Functional Significance:

    • Protein turnover rates correlate with specific developmental stages and environmental conditions.

    • This dynamic regulation ensures optimal photosynthetic efficiency during grain filling, which is critical for yield determination .

These findings suggest that strategies to modulate protein turnover rates could potentially enhance photosynthetic efficiency and grain development in wheat.

What are the key differences between Photosystem Q(B) protein response to biotic stress versus abiotic stress?

Photosystem Q(B) protein exhibits distinct response patterns when wheat is exposed to biotic versus abiotic stresses, with implications for stress tolerance mechanisms:

Biotic Stress Responses:

  • During yellow rust infection (caused by Puccinia striiformis f. sp. tritici), proteomic analyses reveal that Photosystem Q(B) protein (P12463) shows reduced abundance (down-regulation) .

  • This down-regulation occurs alongside the induction of pathogenesis-related proteins such as PR1 and PR4, suggesting a coordinated response where photosynthetic capacity is sacrificed to prioritize defense mechanisms .

  • The proteome reconfiguration during pathogen attack includes:

    • Decreased levels of multiple photosynthetic proteins (Photosystem II cp47, Photosystem Q(B), RuBisCo)

    • Increased expression of defense-related proteins

    • Enhanced production of reactive oxygen species (ROS) scavenging enzymes

Abiotic Stress Responses:

  • Under conditions like drought or high light stress, Photosystem Q(B) protein typically shows altered turnover rates rather than complete down-regulation.

  • The protein becomes increasingly susceptible to damage under these conditions, necessitating more rapid replacement.

  • The stress response involves:

    • Increased association with chaperones and repair mechanisms

    • Modified post-translational regulation

    • Altered interaction with other PSII components

This differential regulation allows plants to optimize resource allocation during different types of stress, prioritizing defense during pathogen attack while maintaining photosynthetic capacity during abiotic challenges when possible.

What strategies can improve the stability and activity of recombinant Photosystem Q(B) protein for in vitro studies?

Improving the stability and activity of recombinant Photosystem Q(B) protein for in vitro studies requires addressing several challenges inherent to membrane proteins. Based on current research, the following strategies have proven effective:

Buffer Optimization:

  • Incorporate specific lipids or lipid mixtures that mimic the native thylakoid membrane environment.

  • Use trehalose (6% is commonly effective) as a stabilizing agent to prevent protein denaturation during freeze-thaw cycles .

  • Maintain pH in the range of 7.5-8.0, which approximates the stromal pH where parts of the protein naturally reside.

Structural Stabilization:

  • Engineer strategic disulfide bonds to enhance structural integrity without compromising active sites.

  • Co-express with natural binding partners or synthetic stabilizing peptides.

  • Consider fusion protein approaches that maintain the core functional domains while improving solubility.

Expression System Refinements:

  • Optimize codon usage for the expression host to enhance translation efficiency.

  • Employ specialized E. coli strains designed for membrane protein expression.

  • Explore alternative expression systems (insect cells, yeast) that may provide more plant-like post-translational modifications.

Purification Considerations:

  • Use mild detergents for solubilization, with n-dodecyl β-D-maltoside (DDM) often providing good results for photosynthetic proteins.

  • Implement rapid purification protocols to minimize time between cell lysis and final storage.

  • Consider on-column refolding techniques if inclusion body formation is problematic.

Storage Enhancements:

  • Flash-freeze aliquots in liquid nitrogen before transferring to -80°C storage.

  • Add glycerol to a final concentration of 50% to prevent ice crystal formation .

  • Consider lyophilization with appropriate excipients for long-term storage of bulk material.

Implementing these approaches can significantly improve experimental reproducibility and enable more sophisticated functional studies of this challenging but important photosynthetic protein.

How does Triticum aestivum Photosystem Q(B) protein differ from homologous proteins in other plant species?

Triticum aestivum (wheat) Photosystem Q(B) protein shows both conservation and divergence when compared to homologs in other plant species. These differences reflect evolutionary adaptations to specific photosynthetic requirements:

Sequence Conservation Analysis:

Species ComparisonSequence Identity (%)Key Functional DomainsNotable Differences
Arabidopsis thaliana85-90%Highly conserved QB binding pocketVariations in N-terminal signal sequence
Oryza sativa (rice)92-95%Nearly identical core regionsMinor differences in stromal loop regions
Zea mays (maize)88-92%Conserved transmembrane helicesAdaptations in heat-responsive elements
Hordeum vulgare (barley)97-99%Virtually identical functional domainsMinimal variations reflecting close evolutionary relationship

While the core functional domains responsible for quinone binding and electron transfer are highly conserved across species, variations exist primarily in regulatory regions and domains involved in protein-protein interactions with other photosystem components. These differences likely contribute to species-specific responses to environmental conditions such as light intensity, temperature ranges, and water availability.

Arabidopsis studies have demonstrated that despite sequence differences, functional conservation is strong enough that the loss of PsbQ proteins induces similar phenotypes across species, particularly under low light conditions where photosynthetic efficiency becomes more critical .

What methodological approaches are most effective for studying protein-protein interactions involving Photosystem Q(B) protein?

Investigating protein-protein interactions involving Photosystem Q(B) protein requires specialized approaches that accommodate its membrane-embedded nature. The following methodologies have proven particularly effective:

  • Co-Immunoprecipitation with Membrane Solubilization:

    • Utilizing mild detergents (digitonin or n-dodecyl β-D-maltoside) to solubilize membrane complexes while preserving protein-protein interactions.

    • Leveraging the His-tag on recombinant proteins for pull-down assays followed by mass spectrometry to identify interaction partners .

  • Crosslinking Mass Spectrometry (XL-MS):

    • Applying membrane-permeable crosslinkers to stabilize transient interactions before protein extraction.

    • Using mass spectrometry to identify crosslinked peptides, providing spatial information about interacting domains.

    • This approach has successfully mapped the architecture of photosystem complexes in various species.

  • Split-Ubiquitin Yeast Two-Hybrid System:

    • A specialized variation of Y2H designed specifically for membrane proteins.

    • Allows screening of interaction partners in a cellular context.

    • Has been successfully applied to identify novel interactions within photosynthetic complexes.

  • FRET/BRET Analysis in Plant Protoplasts:

    • Expressing fluorescently tagged proteins in plant protoplasts to observe interactions in near-native conditions.

    • Particularly valuable for monitoring dynamic interactions under different physiological conditions.

  • Native Gel Electrophoresis Combined with Western Blotting:

    • Blue native PAGE preserves protein complexes during separation.

    • Subsequent immunoblotting with specific antibodies can identify complex components.

    • This approach effectively demonstrates the incorporation of recombinant proteins into native-like complexes.

  • Cryo-Electron Microscopy:

    • Modern cryo-EM approaches allow visualization of membrane protein complexes at near-atomic resolution.

    • Provides structural context for understanding interaction interfaces.

    • Has revolutionized our understanding of photosystem architecture in recent years.

These complementary approaches provide a comprehensive toolkit for investigating both stable and transient interactions involving Photosystem Q(B) protein, enabling researchers to build detailed interaction networks that explain photosystem assembly, function, and regulation.

How do post-translational modifications affect Photosystem Q(B) protein function in different environmental conditions?

Post-translational modifications (PTMs) of Photosystem Q(B) protein play crucial roles in regulating its function across varying environmental conditions. These modifications provide a rapid response mechanism to changing conditions without requiring new protein synthesis:

Major PTMs and Their Functional Impact:

Post-translational ModificationEnvironmental TriggerFunctional ConsequenceDetection Method
PhosphorylationHigh light stressFacilitates PSII repair cycle by marking damaged D1 for degradationPhospho-specific antibodies; LC-MS/MS
Oxidative modificationsROS accumulation during stressCan lead to functional impairment requiring protein replacementRedox proteomics; carbonyl detection assays
AcetylationMetabolic status changesModulates protein-protein interactions within PSIIAcetylation-specific antibodies; MS analysis
MethylationDevelopmental transitionsFine-tunes protein stability and turnover ratesMethylation-specific enrichment; MS analysis

Environmental Response Patterns:

  • Light Intensity Adaptations:

    • Under high light conditions, increased phosphorylation rates facilitate more rapid turnover of the D1 protein.

    • This accelerated repair cycle protects PSII from photoinhibition by ensuring damaged proteins are promptly replaced.

  • Temperature Stress Responses:

    • Heat stress induces specific patterns of oxidative modifications.

    • Cold stress alters the phosphorylation status, affecting membrane fluidity and protein mobility.

  • Drought Adaptation:

    • Water limitation triggers specific PTM patterns that help maintain photosynthetic efficiency under water deficit.

    • These modifications often involve changes to charged residues that affect protein-protein interactions within the photosystem.

  • Developmental Regulation:

    • During wheat grain development, different PTM patterns correlate with changing metabolic priorities.

    • Approximately 25% of newly synthesized proteins undergo turnover rather than being stored, suggesting active quality control mechanisms involving PTM-guided processes .

Understanding these modification patterns has significant implications for crop improvement, as engineering plants with optimized PTM responses could enhance photosynthetic efficiency and stress tolerance in agricultural settings.

What are the most promising approaches for engineering enhanced Photosystem Q(B) protein functionality in crops?

Engineering enhanced Photosystem Q(B) protein functionality represents a frontier opportunity for improving crop photosynthetic efficiency. Several promising approaches warrant further investigation:

The successful implementation of these approaches could contribute to developing climate-resilient crops with improved photosynthetic efficiency, ultimately supporting global food security challenges.

What methodological gaps currently limit our understanding of Photosystem Q(B) protein dynamics in vivo?

Despite significant advances, several methodological limitations continue to constrain our comprehensive understanding of Photosystem Q(B) protein dynamics in living plants:

Addressing these methodological gaps will require interdisciplinary collaborations between plant biologists, biophysicists, analytical chemists, and computational scientists to develop next-generation technologies for studying this critical photosynthetic protein.

How might climate change impact Photosystem Q(B) protein function in major crop species?

Climate change presents multiple challenges to Photosystem Q(B) protein function in crops like wheat, with complex implications for agricultural productivity. Current research points to several critical areas of impact:

Temperature Effects:

  • Rising global temperatures accelerate the rate of Photosystem Q(B) protein damage, particularly through D1 protein oxidation.

  • This increases the metabolic costs of maintaining photosynthetic function, as damaged proteins must be removed and replaced.

  • Research indicates that approximately 20% of grain ATP production is already dedicated to proteome maintenance , suggesting limited capacity to accommodate increased repair demands.

Water Availability Impacts:

  • Drought conditions alter the thylakoid membrane environment where Photosystem Q(B) protein functions.

  • This affects protein-protein interactions within photosystem complexes and can compromise electron transport efficiency.

  • Changes in membrane fluidity under water stress conditions may accelerate protein degradation rates.

Atmospheric CO₂ Concentration Effects:

Adaptation Potential:

  • Natural variation in Photosystem Q(B) protein sequences across wheat varieties suggests existing genetic resources for climate adaptation.

  • Comparative studies between wheat cultivars from different climatic regions reveal adaptations in protein stability and repair mechanisms.

  • This genetic diversity could be leveraged through traditional breeding or precision engineering approaches.

Research Priorities:

  • Identifying wheat varieties with naturally enhanced Photosystem Q(B) protein stability under combined stresses.

  • Developing high-throughput phenotyping methods to screen for superior photosynthetic performance under projected climate conditions.

  • Investigating the interplay between protein turnover rates and photosynthetic efficiency under fluctuating conditions typical of climate change scenarios.

These findings highlight the urgency of developing climate-resilient crops with optimized photosynthetic machinery to ensure food security in a changing climate.

How can recombinant Photosystem Q(B) protein be utilized in developing biosensors for environmental monitoring?

Recombinant Photosystem Q(B) protein offers unique properties that can be harnessed for creating advanced biosensors for environmental monitoring applications. Several promising approaches include:

Herbicide Detection Systems:

  • The QB binding site in Photosystem II is the target for many herbicides (triazines, ureas, etc.).

  • Recombinant Photosystem Q(B) protein can be incorporated into electrochemical or optical sensors that detect binding of these compounds.

  • Changes in electron transfer efficiency upon herbicide binding can be measured as an electrical signal or fluorescence change.

  • This approach enables sensitive detection of herbicide contamination in water samples, soil extracts, or agricultural runoff.

Heavy Metal Monitoring:

  • Heavy metals inhibit photosynthetic electron transport by interacting with key amino acid residues in the Photosystem Q(B) protein.

  • Engineered variants with enhanced sensitivity to specific metals can serve as selective biosensing elements.

  • The immobilization of His-tagged recombinant protein on transducer surfaces facilitates device fabrication.

  • Such sensors could provide real-time monitoring of water quality in natural waterways and agricultural systems.

Light Quality Sensors:

  • The photosynthetic electron transport chain responds differently to various light wavelengths.

  • Recombinant Photosystem Q(B) protein can be incorporated into sensors that detect changes in light quality.

  • These devices could monitor environmental conditions relevant to photosynthetic organisms in aquatic ecosystems.

Methodology for Biosensor Development:

  • Immobilization strategies:

    • Covalent attachment to functionalized surfaces

    • Entrapment within biomimetic membranes

    • Layer-by-layer assembly with other photosynthetic components

  • Signal transduction mechanisms:

    • Electrochemical detection of electron transfer

    • Fluorescence-based monitoring of redox state

    • Surface plasmon resonance for binding event detection

The development of these biosensors would benefit from the availability of high-quality recombinant protein with well-characterized properties and stability profiles, as described in the protein specifications .

What are the critical quality control parameters for analyzing recombinant Photosystem Q(B) protein in research applications?

Ensuring the quality and functionality of recombinant Photosystem Q(B) protein is essential for reliable research outcomes. The following quality control parameters should be systematically assessed:

Purity Assessment:

  • SDS-PAGE Analysis:

    • Confirms protein size (expected ~38.9 kDa for Triticum aestivum Photosystem Q(B) protein) .

    • Verifies purity level (should exceed 90% for most research applications) .

    • Detects potential degradation products or contaminants.

  • Size Exclusion Chromatography:

    • Evaluates aggregation state and oligomerization profile.

    • Confirms homogeneity of the preparation.

Structural Integrity Verification:

  • Circular Dichroism (CD) Spectroscopy:

    • Confirms proper secondary structure formation.

    • Provides a baseline for stability studies under various conditions.

  • Limited Proteolysis:

    • Probes the accessibility of protease-sensitive sites.

    • Indicates correct folding and domain organization.

Functional Analysis:

  • Quinone Binding Assays:

    • Measures binding affinity for plastoquinone analogues.

    • Confirms that the QB binding pocket maintains native-like properties.

  • Electron Transfer Capability:

    • Assesses electron acceptance/donation using artificial electron donors/acceptors.

    • Provides a quantitative measure of functional integrity.

Tag Functionality and Accessibility:

  • Western Blot Analysis:

    • Confirms the presence and integrity of the His-tag.

    • Ensures the tag is accessible for purification and detection .

  • Metal Affinity Binding:

    • Quantitatively assesses the binding capacity to Ni²⁺ or other metal affinity matrices.

    • Verifies uniform tag accessibility across the protein preparation.

Stability Parameters:

  • Thermal Stability:

    • Determines the temperature range for maintained structure and function.

    • Establishes storage and handling guidelines.

  • Time-Course Stability:

    • Monitors functional parameters over time under various storage conditions.

    • Defines practical shelf-life for research applications.

Batch Consistency Measures:

  • Lot-to-Lot Comparison:

    • Ensures reproducibility between production batches.

    • Compares key parameters including specific activity and purity.

  • Certificate of Analysis Documentation:

    • Provides comprehensive characterization data.

    • Documents production conditions and quality control results.

These quality control parameters ensure that experimental results obtained using recombinant Photosystem Q(B) protein are reliable, reproducible, and truly reflect the protein's biological properties rather than artifacts of preparation or storage.

How does research on Photosystem Q(B) protein intersect with synthetic biology approaches to artificial photosynthesis?

Research on Photosystem Q(B) protein provides critical insights for synthetic biology approaches to artificial photosynthesis, creating opportunities for both fundamental science and applied technologies:

Modular Design Principles:

  • Detailed structural and functional characterization of Photosystem Q(B) protein from Triticum aestivum informs the design of simplified, modular components for artificial photosynthetic systems.

  • The natural protein's ability to bind quinones and facilitate electron transfer serves as a blueprint for synthetic electron transport chains.

  • Understanding the specific amino acid residues involved in cofactor binding and electron transport enables rational design of minimal functional units.

Stability Engineering:

  • Analysis of Photosystem Q(B) protein stability under various conditions guides the development of robust synthetic components.

  • The protein's natural turnover mechanisms during wheat grain development provide insights for designing self-repairing synthetic systems.

  • Incorporation of trehalose and other stabilizing agents used for recombinant protein storage into artificial membrane systems can enhance longevity.

Hybrid Systems Development:

  • Recombinant Photosystem Q(B) protein can be directly incorporated into hybrid biological-artificial photosynthetic devices.

  • His-tagged versions facilitate controlled orientation and attachment to electrodes or other inorganic components.

  • These bio-hybrid approaches leverage the efficiency of biological components while addressing scalability through synthetic materials.

Energy Conversion Optimization:

  • Studies of electron transfer kinetics in the natural protein guide the design of synthetic systems with optimized energy conversion efficiency.

  • Understanding the ATP cost of protein maintenance in natural systems (approximately 20% of total grain ATP production) helps establish realistic energy budgets for artificial photosynthesis.

Practical Applications Emerging from This Intersection:

  • Solar fuel production systems that incorporate design principles from Photosystem Q(B) protein.

  • Biomimetic sensors for environmental monitoring based on electron transfer properties.

  • Self-assembling nanostructures for light harvesting and energy conversion.

This interdisciplinary research area represents a promising frontier where understanding of natural photosynthetic proteins directly informs the development of next-generation clean energy technologies.

What insights from structural biology have most significantly advanced our understanding of Photosystem Q(B) protein function?

Structural biology has provided transformative insights into Photosystem Q(B) protein function, revolutionizing our understanding of its role in photosynthesis and enabling new research directions:

Key Structural Breakthroughs:

  • High-Resolution Structures:

    • Cryo-electron microscopy and X-ray crystallography have revealed the precise architecture of the QB binding pocket.

    • These structures show how the protein coordinates with cofactors and other PSII components.

    • The amino acid sequence of Triticum aestivum Photosystem Q(B) protein can now be mapped to specific structural domains with clear functional roles.

  • Conformational Dynamics:

    • Time-resolved structural studies have captured different states during the electron transfer process.

    • These studies reveal how protein conformational changes facilitate sequential electron transfers.

    • The flexibility of specific regions correlates with the protein's susceptibility to damage under stress conditions.

  • Membrane Integration:

    • Structural studies have elucidated how the protein's transmembrane helices position it within the thylakoid membrane.

    • This precise positioning is critical for interactions with other photosystem components and for maintaining the proper electrical gradient.

Functional Implications:

  • Mechanism of Herbicide Binding:

    • Structural studies have revealed how herbicides compete with plastoquinone for the QB binding site.

    • This understanding has informed the development of herbicide-resistant crops and more selective herbicides.

  • Repair Cycle Visualization:

    • Structures of damaged D1 protein have illuminated how specific regions become susceptible to proteolytic degradation.

    • This information connects to observations about protein turnover rates in wheat and explains why approximately 25% of newly synthesized proteins undergo turnover rather than storage.

  • Species-Specific Adaptations:

    • Comparing structures across species has revealed how subtle variations in protein architecture contribute to performance differences under varied environmental conditions.

    • These comparisons help explain why certain species show greater photosynthetic efficiency or stress tolerance.

Methodological Advances:

  • Membrane Protein Crystallization:

    • Development of specialized techniques for crystallizing membrane proteins has been crucial for structural studies of Photosystem Q(B) protein.

    • These methods continue to evolve, providing increasingly detailed views of protein organization.

  • Single-Particle Cryo-EM:

    • Advances in cryo-EM have enabled visualization of photosystem complexes without crystallization.

    • This approach captures more native-like states and reveals heterogeneity within protein populations.

The structural insights gained through these approaches continue to guide hypothesis generation, experimental design, and interpretation of functional data across the field of photosynthesis research.

What are the most common technical challenges when working with recombinant Photosystem Q(B) protein and how can they be addressed?

Working with recombinant Photosystem Q(B) protein presents several technical challenges due to its membrane protein nature and complex functionality. Here are the most common issues researchers encounter and evidence-based solutions:

Expression and Yield Challenges:

ChallengeManifestationSolution Approach
Low expression levelsMinimal protein band in SDS-PAGEOptimize codon usage for expression host; use specialized strains (C41/C43); reduce expression temperature to 18-20°C
Inclusion body formationInsoluble protein fractionExpress with fusion partners (MBP, SUMO); co-express with chaperones; use cell-free expression systems
Toxicity to expression hostPoor growth of expression culturesUse tightly controlled induction systems; reduce expression time; employ specialized "toxicity-tolerant" E. coli strains

Purification Difficulties:

  • Protein Aggregation:

    • Problem: Tendency to form aggregates during extraction and purification.

    • Solution: Use mild detergents (DDM, LMNG) at concentrations just above CMC; add glycerol (5-10%) to all buffers; maintain samples at 4°C throughout purification .

  • Cofactor Loss:

    • Problem: Loss of essential cofactors during purification affects functionality.

    • Solution: Supplement buffers with specific cofactors; minimize exposure to harsh conditions; verify cofactor binding using spectroscopic methods.

  • His-Tag Accessibility:

    • Problem: Buried or inaccessible His-tag reducing purification efficiency.

    • Solution: Try both N-terminal and C-terminal tag positions; use longer linkers between protein and tag; consider alternative purification approaches if necessary .

Stability Issues:

  • Short Half-Life in Solution:

    • Problem: Rapid activity loss after purification.

    • Solution: Add stabilizing agents (trehalose at 6%); store in Tris/PBS-based buffer at pH 8.0; maintain in 50% glycerol for freeze storage .

  • Freeze-Thaw Sensitivity:

    • Problem: Activity loss upon freezing and thawing.

    • Solution: Avoid repeated freeze-thaw cycles; prepare single-use aliquots; consider flash-freezing in liquid nitrogen before -80°C storage .

Functional Assessment Challenges:

  • Reconstitution into Membranes:

    • Problem: Difficult to incorporate into liposomes for functional studies.

    • Solution: Use gradual detergent removal methods (dialysis, Bio-Beads); try different lipid compositions to mimic native thylakoid environment.

  • Artificial Electron Acceptor Compatibility:

    • Problem: Inconsistent electron transfer to artificial acceptors.

    • Solution: Screen multiple acceptor types; optimize buffer conditions for specific electron transfer assays; ensure anaerobic conditions when necessary.

These solutions have been developed through extensive research experience and represent current best practices in the field. Implementation of these approaches can significantly improve research outcomes when working with this challenging but important photosynthetic protein.

How can researchers distinguish between native and recombinant Photosystem Q(B) protein functions in experimental settings?

Distinguishing between native and recombinant Photosystem Q(B) protein functions requires careful experimental design and multiple analytical approaches. The following methodologies enable researchers to make these critical distinctions:

Structural Comparison Techniques:

  • Mass Spectrometry Profiling:

    • Identifies post-translational modifications present in native protein but absent in recombinant versions.

    • Can detect subtle mass differences due to the presence of the His-tag or other modifications in recombinant protein .

    • Particularly useful for analyzing protein extracted from complementation studies.

  • Circular Dichroism Spectroscopy:

    • Compares secondary structure elements between native and recombinant proteins.

    • Can detect folding differences that might affect function.

    • Provides quantitative measures of structural similarity.

Functional Discrimination Approaches:

  • Electron Transfer Kinetics:

    • Measures the rate of electron transfer from QA to QB.

    • Native protein typically exhibits faster kinetics due to optimal positioning within the photosystem complex.

    • Differences in kinetic parameters can quantify functional equivalence.

  • Herbicide Binding Properties:

    • Compares binding affinity of herbicides that target the QB site.

    • Differences in IC50 values indicate alterations in binding pocket architecture.

    • This approach is particularly sensitive to subtle functional differences.

Complementation Strategies:

  • Genetic Complementation with Tagged Variants:

    • Introduce recombinant protein into plants with reduced endogenous protein (e.g., RNAi plants) .

    • Use the tag to distinguish recombinant from any remaining native protein.

    • Assess restoration of photosynthetic parameters such as oxygen evolution rates and chlorophyll fluorescence.

  • Competitive Incorporation Assays:

    • Mix differentially tagged native and recombinant proteins in reconstitution experiments.

    • Analyze which version preferentially incorporates into functional complexes.

    • Provides direct comparison of assembly competence.

Stability and Turnover Distinction:

  • Pulse-Chase Experiments:

    • Label proteins and track their degradation over time.

    • Compare turnover rates between native and recombinant versions.

    • Relates to observations that approximately 25% of newly synthesized proteins undergo turnover during wheat grain development .

  • Stress Response Profiling:

    • Subject both protein forms to identical stress conditions.

    • Compare their susceptibility to damage and rates of repair.

    • Reveals differences in structural robustness under physiological challenges.

These methodological approaches provide complementary data on the structural and functional equivalence of native and recombinant Photosystem Q(B) protein, enabling researchers to appropriately interpret experimental results and develop improved recombinant versions with more native-like properties.

What core experimental competencies should graduate students develop to effectively work with Photosystem Q(B) protein?

Graduate students entering the field of Photosystem Q(B) protein research should develop a specific set of experimental competencies to effectively contribute to this challenging area. These skills build upon basic biochemistry training to address the unique challenges of this photosynthetic membrane protein:

Fundamental Techniques:

  • Recombinant Protein Expression and Purification:

    • Competency in E. coli-based expression systems optimized for membrane proteins.

    • Proficiency with affinity chromatography using His-tagged constructs .

    • Experience with detergent solubilization and membrane protein handling.

  • Protein Biochemistry Methods:

    • SDS-PAGE and western blotting for protein detection and quantification.

    • Spectrophotometric assays for protein concentration determination.

    • Circular dichroism for secondary structure analysis.

  • Plant Physiology Techniques:

    • Chlorophyll fluorescence measurements for assessing photosystem function.

    • Oxygen evolution analysis using Clark-type electrodes.

    • Isolation of intact chloroplasts and thylakoid membranes.

Advanced Methodologies:

  • Biophysical Characterization:

    • Time-resolved spectroscopy to follow electron transfer events.

    • EPR spectroscopy for analyzing cofactor environments.

    • Thermal stability assays to assess protein folding and stability.

  • Functional Reconstitution:

    • Proteoliposome preparation for functional studies.

    • Artificial electron transport chain assembly.

    • Electrochemical techniques for measuring electron transfer.

  • Molecular Biology Tools:

    • Site-directed mutagenesis for structure-function analysis.

    • RNAi construct design for gene suppression studies .

    • CRISPR-Cas9 approaches for generating plant mutants.

Data Analysis and Computational Skills:

  • Bioinformatics Competencies:

    • Sequence analysis and homology modeling.

    • Structural visualization of protein complexes.

    • Phylogenetic analysis of protein evolution across species.

  • Statistical Analysis:

    • Experimental design with appropriate controls.

    • Statistical testing for significance determination.

    • Data visualization approaches for complex datasets.

Professional Development Areas:

  • Literature Knowledge:

    • Comprehensive understanding of photosystem structure and function.

    • Familiarity with research on protein turnover in plant development .

    • Awareness of cutting-edge techniques in membrane protein research.

  • Collaborative Skills:

    • Experience working in interdisciplinary teams.

    • Ability to communicate across specialty boundaries.

    • Understanding of how their research connects to broader questions in photosynthesis.

Developing these competencies will prepare graduate students to make meaningful contributions to our understanding of Photosystem Q(B) protein and position them for success in this challenging but important research area.

What are the most significant unanswered questions about Photosystem Q(B) protein that warrant further investigation?

Despite decades of research, several significant questions about Photosystem Q(B) protein remain unanswered, presenting valuable opportunities for transformative discoveries:

Molecular Mechanism Questions:

  • Damage and Repair Dynamics:

    • What molecular triggers initiate the degradation of damaged Photosystem Q(B) protein?

    • How is the balance between repair and replacement regulated under different stress conditions?

    • Research has shown that approximately 25% of newly synthesized proteins undergo turnover during wheat grain development , but the specific mechanisms governing this process remain unclear.

  • Conformational Flexibility:

    • How do protein dynamics facilitate electron transfer between QA and QB?

    • What role does protein flexibility play in adaptation to fluctuating environmental conditions?

    • Are there specific conformational states that confer resistance to photoinhibition?

Regulatory Network Questions:

  • Integration with Cellular Signaling:

    • How is Photosystem Q(B) protein synthesis coordinated with other components of the photosynthetic apparatus?

    • What signaling pathways modulate its expression under varying light conditions?

    • How do retrograde signals from the chloroplast regulate nuclear gene expression of factors affecting D1 function?

  • Post-Translational Control:

    • What is the complete catalog of PTMs on Photosystem Q(B) protein across development and stress conditions?

    • How do these modifications work in concert to fine-tune protein function?

    • Which enzymes mediate these modifications, and how are they themselves regulated?

Evolutionary and Comparative Questions:

  • Adaptive Variations:

    • What sequence variations in Photosystem Q(B) protein contribute to differential photosynthetic efficiency across wheat varieties?

    • How have different species evolved distinct regulatory mechanisms for this protein?

    • Can evolutionary insights inform crop improvement strategies?

  • System Integration:

    • How does Photosystem Q(B) protein interact with the broader proteomic landscape during stress responses?

    • Proteomic analyses have identified coordinated responses during yellow rust infection, where Photosystem Q(B) protein shows reduced abundance alongside changes in other proteins – but the regulatory networks governing these coordinated responses remain largely unknown.

Applied Research Questions:

  • Engineering Potentials:

    • Can targeted modifications to Photosystem Q(B) protein enhance photosynthetic efficiency under suboptimal conditions?

    • What are the trade-offs between stability, repair efficiency, and electron transfer rates?

    • How can insights from recombinant protein studies inform the design of improved crop varieties?

  • Climate Resilience:

    • How will climate change factors specifically impact Photosystem Q(B) protein function?

    • Can we develop varieties with enhanced resilience to combined stresses?

    • What role could this protein play in adaptation strategies for agriculture?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.