Recombinant Triticum timopheevii ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Expression

The recombinant ATP6 protein is synthesized via heterologous expression in E. coli, followed by affinity chromatography (His-tag purification). Key steps include:

  1. Cloning: The ATP6 gene (1–386 aa) is fused to an N-terminal His tag for solubility and purification .

  2. Purification: Achieves >90% purity via SDS-PAGE, with lyophilization for long-term stability .

  3. Reconstitution: Requires dissolution in Tris/PBS buffer (pH 8.0) with glycerol to prevent aggregation .

4.1. Mechanistic Studies

  • Proton Channel Dynamics: Structural analyses reveal ATP6’s role in directing protons to the c-ring, essential for rotational catalysis . Mutations in ATP6 (e.g., m.8993 T>G in humans) disrupt proton flow, leading to ATP synthesis defects .

  • Disease Modeling: ATP6 mutations are linked to mitochondrial disorders such as neuropathy, ataxia, and retinitis pigmentosa (NARP) . Recombinant ATP6 enables in vitro studies of these pathogenic variants .

4.2. Agricultural Relevance

  • Wheat Mitochondrial Genomics: Comparative analyses of Triticum species highlight ATP6’s conserved role in energy metabolism, with implications for cytoplasmic male sterility (CMS) in hybrid wheat breeding .

Comparative Analysis with Orthologs

ATP6 homologs across species share structural and functional conservation:

SpeciesUniProt IDKey Features
Homo sapiens (Human)P00846Associated with Leigh syndrome, NARP
Saccharomyces cerevisiaeP00846Used for mitochondrial disease modeling
Smittium culisetaeQ3T4C2Similar transmembrane topology

Future Directions

  • Drug Discovery: Targeting ATP6 mutations (e.g., m.8993 T>G) could mitigate mitochondrial disorders .

  • Structural Biology: Cryo-EM studies of recombinant ATP6 may elucidate proton channel mechanics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your desired format in the order notes for our consideration.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. For dry ice shipping, please communicate your request in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while the shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us so we can prioritize its inclusion during development.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Triticum timopheevii (Timopheev's wheat) (Triticum dicoccon var. timopheevii)
Target Names
ATP6
Target Protein Sequence
MRFLSTDMKDRNMLFAAITTNQPIRSKCSRLPDLHDFFPTNISQNFAITPNLDITPTPER IAGVTIVLQIEEYLGQNESEQGAVNLARTVLGARHRNGETWQGILEDIRAGGGMDNFIQN LPGAYPETPLDQFAIIPIIDLHVGNFYLSFTNEVLYMLLTVVLVVFLFFVVTKKGGGKSV PNAWQSLVELIYDFVLNLVNEQIGGLSGNVKQKFFPRISVTFTFSLFRNPQGMIPFSFTV TSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRAL SLGIRLFANMMAGHSLVKILSGFAWTMLFLNNIFYFIGDLGPLFIVLALTGLELGVAISQ AHVSTISICIYLNDATNLHQNESFHN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes of the respiratory chain. F-type ATPases comprise two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked via a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits. As a key component of the proton channel, subunit a may play a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Triticum timopheevii ATP synthase subunit a (ATP6)?

Recombinant Triticum timopheevii ATP synthase subunit a (ATP6) is a protein component of the mitochondrial F₀F₁-ATP synthase complex (Complex V) derived from Timopheev's wheat. The full-length protein consists of 386 amino acids (UniProt ID: P68526) and plays a critical role in the formation of the proton channel within the F₀ portion of ATP synthase . For recombinant expression, the protein is typically produced in E. coli with an N-terminal histidine tag to facilitate purification and subsequent experimental applications . The protein functions within the mitochondrial inner membrane as part of the machinery responsible for ATP production during oxidative phosphorylation.

How should Recombinant Triticum timopheevii ATP6 protein be stored and reconstituted for experimental use?

For optimal stability and functionality in experimental applications, Recombinant Triticum timopheevii ATP6 requires specific storage and reconstitution protocols:

Storage Protocol:

  • Lyophilized form: Store at -20°C to -80°C for up to 12 months

  • Reconstituted liquid form: Stable for approximately 6 months at -20°C to -80°C

  • Working aliquots: Store at 4°C for up to one week to avoid repeated freeze-thaw cycles

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Aliquot for long-term storage at -20°C to -80°C

This approach preserves protein integrity by preventing degradation from repeated freeze-thaw cycles while maintaining structural and functional properties for downstream applications.

What expression systems are commonly used for producing Recombinant Triticum timopheevii ATP6?

E. coli is the predominant expression system for Recombinant Triticum timopheevii ATP6 production due to its efficiency, scalability, and cost-effectiveness . The process typically involves:

  • Cloning the ATP6 coding sequence into an appropriate expression vector containing a His-tag sequence

  • Transforming the construct into a compatible E. coli strain (commonly BL21(DE3) or derivatives)

  • Inducing protein expression under optimized conditions (temperature, IPTG concentration, duration)

  • Cell lysis and protein purification via affinity chromatography (Ni-NTA resin)

  • Concentration and buffer exchange to obtain the final product

What is the relationship between ATP6 and cytoplasmic male sterility in Triticum timopheevii?

ATP6 plays a significant role in cytoplasmic male sterility (CMS) in Triticum timopheevii, representing an important model for nuclear-mitochondrial interactions in plants. Research has established that:

  • In plants with Triticum timopheevii cytoplasm-based CMS (T-CMS), the expression of nuclear genes encoding specific ATP synthase subunits is repressed in anther tissues

  • The nuclear gene TaF(A)d that encodes the F(A)d subunit of F₀F₁-ATP synthase shows reduced expression specifically in anthers of CMS plants with timopheevii cytoplasm

  • This repression pattern indicates a mitochondrial retrograde regulation mechanism affecting nuclear gene expression

  • The Rf1 and Rf3 genes can restore fertility in wheat plants with T-CMS by binding to mitochondrial orf279 transcript and inducing cleavage, preventing expression of the CMS trait

This relationship between ATP6 and CMS provides a valuable experimental system for studying mitochondrial-nuclear communication and the molecular basis of reproductive biology in plants.

How does assembly-dependent translation regulation affect ATP6 expression and function?

Recent research challenges conventional understanding of ATP synthase assembly, particularly regarding ATP6 expression. Evidence indicates sophisticated regulatory mechanisms involving feedback loops between protein assembly and translation:

  • Translation of subunit 6 (ATP6) is enhanced in specific mutant strains that exhibit assembly defects in the ATP synthase complex

  • These translation modifications involve assembly intermediates interacting with ATP6 within the final ATP synthase complex

  • cis-regulatory sequences in the ATP6 gene control its expression in response to assembly status

  • The 5'-UTR of ATP6 appears to play a critical role in this assembly-dependent regulation mechanism

Assembly StateATP6 Translation RateRegulatory Mechanism
Normal assemblyBaseline rateStandard translational control
Assembly defect (L173P mutation)Enhanced rateFeedback loop increases translation
F₁ or 9 10-ring defectsVariable responseDependent on specific assembly intermediate formation

This assembly-dependent translation represents a sophisticated quality control mechanism ensuring proper stoichiometry of ATP synthase components. For researchers, this highlights the importance of considering the entire assembly process when studying individual ATP synthase subunits and suggests that experimental perturbations of ATP6 may have complex, non-linear effects on the ATP synthase complex.

What methodological approaches are most effective for studying protein-protein interactions involving ATP6 within the ATP synthase complex?

Investigating ATP6 interactions within the ATP synthase complex requires a multi-faceted approach due to the protein's membrane localization and the complex's multisubunit nature. Several complementary methodologies have proven effective:

  • Cross-linking coupled with mass spectrometry (XL-MS)

    • Chemical cross-linkers of varying lengths can capture transient and stable interactions

    • MS analysis identifies interaction partners and specific contact points

    • Particularly valuable for membrane protein complexes like ATP synthase

  • Co-immunoprecipitation with tagged ATP6 variants

    • Requires careful design of tags that don't disrupt native interactions

    • Can be performed under various detergent conditions to preserve different interaction strengths

    • Western blotting with specific antibodies confirms interaction partners

  • Blue Native PAGE (BN-PAGE)

    • Preserves native protein complexes during electrophoretic separation

    • Second-dimension SDS-PAGE identifies individual components

    • Particularly useful for studying assembly intermediates

  • Proximity labeling approaches (BioID, APEX)

    • Enzymatic tags fused to ATP6 label proximal proteins

    • Captures both stable and transient interactions in the native cellular environment

    • Particularly valuable for identifying novel interaction partners

  • Protein interaction prediction and verification

    • Computational tools like STRING indicate high-confidence interaction partners including ATP5F1D and ATP5F1A (score 0.999)

    • These predictions should be experimentally verified using the methods above

For optimal results, researchers should employ multiple complementary approaches, as each method has inherent limitations when studying membrane protein complexes.

How can researchers effectively resolve contradictions in the assembly model of ATP synthase components, particularly regarding the ATP6 and ATP9 subunits?

Recent findings have revealed contradictions in the accepted model of ATP synthase assembly, particularly regarding ATP6 and ATP9. Researchers investigating these contradictions should employ the following methodological approaches:

  • Time-course assembly studies with pulse-chase labeling

    • Label newly synthesized proteins at different time points

    • Track the incorporation of labeled subunits into assembly intermediates

    • Resolves the temporal sequence of assembly steps

  • Genetic manipulation of assembly factors

    • Create conditional knockdowns of known assembly factors

    • Analyze accumulation of specific intermediates

    • Helps identify factor-dependent assembly steps

  • Structural analysis of assembly intermediates

    • Purify assembly intermediates captured at different stages

    • Apply cryo-EM to resolve structures at near-atomic resolution

    • Provides direct evidence of the physical arrangement of subunits

  • In vitro reconstitution experiments

    • Purify individual components and systematically test assembly

    • Examine if ATP9 10-ring formation requires other ATP synthase components

    • Directly addresses the contradiction regarding independent ATP9 ring formation

  • Comparative analysis across species

    • Examine if the contradiction exists in other organisms

    • Determine if assembly pathways differ between yeast, plants, and mammals

The contradictory findings that ATP9 10-ring formation may not occur independently of other ATP synthase components challenge a fundamental aspect of the current assembly model. This represents an opportunity to refine our understanding of ATP synthase biogenesis through rigorous experimental approaches.

What experimental approaches can be used to investigate the mitochondrial retrograde regulation of nuclear genes encoding ATP synthase components in T-CMS systems?

Investigating mitochondrial retrograde regulation in T-CMS systems requires specialized experimental approaches to unravel the complex signaling between mitochondria and the nucleus:

  • Tissue-specific transcriptome analysis

    • Compare gene expression profiles between anthers of fertile and CMS plants

    • Identify differentially expressed genes in ATP synthase pathways

    • RNA-seq data can reveal coordinated regulation patterns

  • Chromatin immunoprecipitation sequencing (ChIP-seq)

    • Identify transcription factors binding to promoters of nuclear ATP synthase genes

    • Determine if chromatin modifications differ between fertile and CMS plants

    • Reveals epigenetic aspects of retrograde regulation

  • Metabolomic profiling

    • Measure ATP/ADP ratios, ROS levels, and other mitochondrial metabolites

    • Compare profiles between fertile and CMS plants

    • Identifies potential retrograde signaling molecules

  • Genetic complementation studies

    • Express wild-type and mutant versions of ATP6 in CMS backgrounds

    • Examine effects on nuclear gene expression

    • Determines if specific ATP6 domains mediate retrograde signaling

  • Proteomic analysis of protein complexes

    • Identify changes in ATP synthase composition between fertile and CMS plants

    • Detect alterations in assembly intermediates

    • Reveals how altered ATP6 affects complex formation

Experimental ApproachKey Information ObtainedTechnical Considerations
Tissue-specific transcriptomeGlobal changes in gene expression patternsRequires microdissection of anther tissues
ChIP-seqDirect transcriptional regulation mechanismsAntibody specificity is critical
Metabolomic profilingPotential signaling moleculesRapid sample processing to prevent degradation
Genetic complementationCausative relationship between ATP6 and nuclear gene expressionRequires efficient transformation system
Proteomic analysisChanges in protein complex compositionMembrane protein solubilization challenges

These approaches can help elucidate how altered mitochondrial ATP6 leads to repression of nuclear genes like TaF(A)d specifically in anthers of CMS plants .

What are the critical factors to consider when using Recombinant Triticum timopheevii ATP6 for structural studies?

Structural studies of Recombinant Triticum timopheevii ATP6 present unique challenges due to its membrane-embedded nature. Researchers should consider these critical factors:

  • Protein solubilization and stability

    • Selection of appropriate detergents (DDM, LMNG, or amphipols) that maintain native conformation

    • Optimization of lipid-to-protein ratios to preserve structural integrity

    • Temperature, pH, and buffer composition significantly impact stability

  • Purification strategy optimization

    • Two-step purification (affinity chromatography followed by size exclusion) improves homogeneity

    • Tag position (N- vs. C-terminal) affects purification efficiency and protein folding

    • Consider on-column detergent exchange during purification

  • Structural analysis method selection

    • Cryo-EM: Increasingly preferred for membrane proteins; requires optimized grid preparation

    • X-ray crystallography: Challenging due to flexible regions; may require LCP crystallization

    • NMR: Limited to specific domains due to size constraints

  • Integration within ATP synthase complex

    • ATP6 structural studies are most informative when performed in the context of the F₀ domain

    • Co-expression with interacting subunits may improve stability and physiological relevance

    • Consider nanodiscs or other membrane mimetics to maintain native environment

  • Sample heterogeneity assessment

    • SEC-MALS analysis to confirm monodispersity

    • Negative-stain EM to evaluate sample quality before cryo-EM

    • Thermal stability assays to optimize buffer conditions

These considerations are essential for generating physiologically relevant structural data that accurately reflects ATP6's conformation and interactions within the ATP synthase complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.