Recombinant Tropheryma whipplei ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Tropheryma whipplei ATP Synthase Subunit b (atpF)

Recombinant Tropheryma whipplei ATP synthase subunit b (atpF) is a protein derived from the bacterium Tropheryma whipplei, which is known for causing Whipple's disease. This disease is a rare, systemic bacterial infection that primarily affects the small intestine but can also impact other parts of the body, including the heart and nervous system . The ATP synthase subunit b plays a crucial role in the energy metabolism of bacteria by participating in the synthesis of ATP, which is essential for various cellular processes.

Structure and Function

The ATP synthase complex is a key enzyme in the process of generating ATP from ADP and inorganic phosphate using the energy derived from a proton gradient across cell membranes. In bacteria, this complex typically consists of two main parts: the F1 sector, which is soluble and contains the catalytic sites for ATP synthesis, and the F0 sector, which is membrane-bound and responsible for proton translocation. The subunit b (atpF) is part of the F0 sector and helps in the translocation of protons across the membrane, driving the synthesis of ATP .

Recombinant Expression

Recombinant Tropheryma whipplei ATP synthase subunit b (atpF) is expressed in Escherichia coli (E. coli), a common host organism for recombinant protein production. This involves cloning the gene encoding the atpF subunit into an expression vector, which is then introduced into E. coli cells. The protein is often tagged with a His-tag to facilitate purification using affinity chromatography .

Clinical Relevance

While the recombinant protein itself is not directly used as a therapeutic agent, understanding its structure and function can provide insights into the pathogenesis of Tropheryma whipplei infections. Whipple's disease is characterized by malabsorption, weight loss, diarrhea, and arthralgia, among other symptoms. The disease can be diagnosed using PCR to detect T. whipplei DNA in tissues, and treatment typically involves long-term antibiotic therapy .

Research Findings

Research on Tropheryma whipplei has highlighted the bacterium's unique lifestyle, which involves residing within the vacuoles of host macrophages. This intracellular lifestyle necessitates a dependence on the host for certain metabolic substrates, as T. whipplei lacks several biosynthetic pathways . The study of ATP synthase subunits like atpF can shed light on how T. whipplei maintains its energy homeostasis within host cells.

Table 1: Characteristics of Recombinant Tropheryma whipplei ATP Synthase Subunit b (atpF)

CharacteristicDescription
Expression HostEscherichia coli
TagN-terminal His-tag
Protein Length1-172 amino acids
FunctionProton translocation in ATP synthesis

Table 2: Comparison of ATP Synthase Subunits Across Different Species

SpeciesATP Synthase SubunitFunction
Tropheryma whippleiSubunit b (atpF)Proton translocation
Thermotoga maritimaSubunit b (atpF)Similar to T. whipplei
Bacillus caldotenaxSubunit c (atpE)Part of F0 sector, proton translocation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; TWT_428; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Tropheryma whipplei (strain Twist) (Whipple's bacillus)
Target Names
atpF
Target Protein Sequence
MKFAQPHNPLLPSVPDIVFSAIVLAIVLPFFWWFVIPRISKLLSDRSSLIEGKISEAASA HARALETLELRKQQLDEAKSEASQIRQEARDDAQLILQQARETADETAERVMLHAREQIQ AEKAAALLSLRSEIATLALAAAGKAVSEKLDDDKKSRELVSASIAKMAEDAG
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) domain, containing the extramembrane catalytic core, and the F(0) domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk that links F(1) to F(0).
Database Links

KEGG: twh:TWT_428

STRING: 203267.TWT428

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the function of ATP synthase subunit b in T. whipplei?

ATP synthase subunit b (atpF) in T. whipplei serves as a critical component of the F₀F₁ ATP synthase complex, which is responsible for ATP production through oxidative phosphorylation. The protein functions specifically within the membrane-embedded F₀ portion and forms part of the peripheral stalk that connects the F₁ catalytic domain to the F₀ proton channel. During catalysis, ATP synthesis in the catalytic domain of F₁ is coupled via a rotary mechanism of the central stalk subunits to proton translocation . In the context of T. whipplei's reduced genome (which contains only 808 predicted ORFs), the maintenance of this energy production machinery suggests its essential nature for bacterial survival within host cells .

How does T. whipplei ATP synthase subunit b compare to homologs in other bacteria?

T. whipplei ATP synthase subunit b shares structural and functional similarities with homologous proteins in other bacteria, particularly other intracellular pathogens. Comparative proteomic analysis reveals that T. whipplei shares protein expression patterns with other host-associated facultative intracellular bacteria rather than with obligate intracellular or environmental bacteria . This similarity in expression profile suggests evolutionary adaptation to similar ecological niches. The protein likely maintains the core structural features necessary for ATP synthase function while potentially harboring unique adaptations that enable T. whipplei's specialized intracellular lifestyle and its ability to manipulate host cellular processes, such as phagosome maturation .

What expression systems are most effective for producing recombinant T. whipplei ATP synthase subunit b?

For efficient expression of recombinant T. whipplei ATP synthase subunit b, E. coli-based expression systems using pET vectors under the control of T7 promoters have proven most effective. When expressing membrane-associated proteins like ATP synthase subunit b, it is crucial to optimize conditions to prevent protein aggregation and ensure proper folding. The use of fusion tags (such as His6 or GST) facilitates purification while potentially enhancing solubility. Expression should be conducted at lower temperatures (16-25°C) with reduced inducer concentrations to minimize inclusion body formation. For structural and functional studies, detergent screening is essential to identify conditions that maintain the native conformation of this transmembrane protein . The purification strategy should include a combination of affinity chromatography followed by size exclusion chromatography to achieve high purity.

How might the ATP synthase of T. whipplei contribute to its unique phagosomal survival strategy?

T. whipplei creates a distinctive intracellular niche by inducing a "chimeric" phagosome that stably expresses both Rab5 and Rab7, effectively blocking phagosome maturation and lysosomal fusion . The ATP synthase complex, including subunit b, may contribute to this survival strategy through several mechanisms. First, the ATP synthase could maintain the pathogen's energy requirements within this specialized compartment. Second, the complex might participate in regulating the internal pH of the T. whipplei-containing phagosome, creating optimal conditions for bacterial survival. Third, components of the ATP synthase, including subunit b, could potentially interact with host factors to modulate the Rab5-to-Rab7 transition process, similar to how T. whipplei's GAPDH is hypothesized to interact with Rab5 . Elucidating these potential roles requires targeted experiments using recombinant atpF to investigate its interaction with host proteins involved in phagosome maturation.

What technical challenges exist in structural determination of T. whipplei ATP synthase subunit b?

Structural determination of T. whipplei ATP synthase subunit b presents several significant challenges. As a transmembrane protein, it contains hydrophobic domains that create difficulties in expression, purification, and crystallization. Researchers must overcome issues of protein aggregation and misfolding during recombinant expression. For X-ray crystallography, the protein must be isolated in detergent micelles or nanodiscs that mimic the native membrane environment while allowing crystal formation. Alternative approaches include cryo-electron microscopy of the intact ATP synthase complex or NMR studies of specific domains. The low abundance of T. whipplei proteins in natural settings necessitates efficient recombinant expression systems. Furthermore, the potential formation of higher-order oligomeric structures adds complexity to structural analysis. These challenges must be addressed through systematic optimization of expression conditions, detergent screening, and potentially the use of fusion partners or truncated constructs focusing on specific domains .

How might immunosuppressive therapies affect T. whipplei ATP synthase activity in vivo?

Immunosuppressive therapies, particularly tumor necrosis factor inhibitors (TNFI), have been associated with complicated courses of Whipple's disease and T. whipplei endocarditis . The effect of these therapies on T. whipplei ATP synthase activity represents an important area for investigation. Immunosuppression may create a permissive environment in which T. whipplei can thrive, potentially upregulating energy metabolism pathways including ATP synthase activity. TNF-α normally activates macrophages to combat intracellular pathogens; its inhibition may reduce macrophage metabolic stress responses that would otherwise target bacterial energy production systems. Additionally, changes in the host cell environment under immunosuppression could alter the expression or activity of T. whipplei ATP synthase. Research methodologies to investigate this relationship would include comparing ATP synthase activity in T. whipplei isolated from immunocompetent versus immunosuppressed host cells, and examining the effects of immunosuppressive drugs on recombinant T. whipplei ATP synthase in vitro .

What are the optimal methods for assessing T. whipplei ATP synthase activity in vitro?

To assess T. whipplei ATP synthase activity in vitro, researchers should employ a multi-faceted approach. ATP synthesis activity can be measured using luciferase-based luminescence assays that quantify ATP production when the purified enzyme or membrane vesicles containing the ATP synthase complex are provided with ADP, inorganic phosphate, and an established proton gradient. For the reverse reaction (ATP hydrolysis), coupled enzyme assays linking ATP hydrolysis to NADH oxidation provide continuous monitoring of activity. Membrane potential-sensitive fluorescent dyes can evaluate proton-pumping activity of reconstituted ATP synthase. When working with recombinant atpF specifically, researchers should assess its ability to complement ATP synthase function in systems where the native subunit b has been deleted or inactivated. Additionally, binding assays using surface plasmon resonance or isothermal titration calorimetry can characterize interactions between recombinant atpF and other ATP synthase subunits or potential host targets .

How can researchers differentiate between effects on ATP synthase and other T. whipplei virulence mechanisms?

Differentiating between effects specifically attributed to ATP synthase and those stemming from other T. whipplei virulence mechanisms requires careful experimental design. Site-directed mutagenesis of atpF can create variants with altered function while maintaining structural integrity, allowing researchers to distinguish between structural and catalytic roles. Conditional expression systems permit temporal control of atpF expression, enabling observation of immediate effects when ATP synthase function is modulated. Selective inhibitors of ATP synthase can be employed alongside appropriate controls targeting other metabolic pathways. Comparative studies using recombinant systems expressing wild-type versus mutant atpF can identify phenotypic differences specifically attributable to ATP synthase function. Additionally, proteomic and transcriptomic analyses following ATP synthase perturbation can reveal compensatory mechanisms and distinguish primary from secondary effects. Together with the known T. whipplei mechanisms for phagosome maturation interference involving the Rab5 GTPase cycle, these approaches can help determine if and how ATP synthase contributes to the unique chimeric phagosome created by this pathogen .

What considerations are important when designing inhibitors targeting T. whipplei ATP synthase?

When designing inhibitors targeting T. whipplei ATP synthase, researchers must balance selectivity, efficacy, and pharmacological properties. First, comparative structural analysis between bacterial and human ATP synthases must identify unique features in the T. whipplei enzyme that can be exploited to achieve selectivity, minimizing off-target effects on host mitochondrial ATP synthase. High-resolution structural data of the T. whipplei ATP synthase, particularly the regions containing subunit b, would greatly facilitate this process. Second, inhibitor design should consider the accessibility of the target within the bacterial phagosome, as compounds must penetrate both host cell and phagosomal membranes to reach the pathogen. Third, researchers should evaluate synergistic effects between ATP synthase inhibitors and current antibiotics used for Whipple's disease treatment. Given that ATP synthase is part of the core metabolic machinery identified in proteomic studies of T. whipplei, it represents a promising antibiotic target . Finally, inhibitor testing must account for the unique microenvironment within the chimeric Rab5/Rab7-positive phagosome that T. whipplei creates, as this may affect inhibitor efficacy or access to the target .

How might systems biology approaches enhance our understanding of T. whipplei ATP synthase in pathogenesis?

Systems biology approaches offer powerful tools for understanding the role of T. whipplei ATP synthase within the broader context of pathogen-host interactions. Integrating transcriptomic, proteomic, and metabolomic data from T. whipplei during different stages of infection can reveal how ATP synthase expression and activity correlate with other virulence factors and metabolic pathways. Network analysis can identify potential regulatory connections between energy metabolism and the mechanisms by which T. whipplei manipulates phagosome maturation. Computational modeling of T. whipplei metabolism, incorporating constraints derived from its reduced genome, can predict the consequences of targeting ATP synthase and inform combination therapies. Furthermore, host-pathogen interaction models can simulate how changes in host cell conditions, including those induced by immunosuppressive therapies, might affect T. whipplei ATP synthase function and bacterial survival . These approaches could reveal unexpected connections between energy metabolism and the unique ability of T. whipplei to create a chimeric Rab5/Rab7-positive phagosomal compartment .

What role might T. whipplei ATP synthase play in adaptation to different host environments?

T. whipplei infects multiple tissues and cell types, suggesting adaptability to diverse host environments. The ATP synthase complex, including subunit b, likely plays a crucial role in this adaptive capacity. The protein may undergo regulatory changes in different host tissues to optimize energy production under varying nutrient availability and oxygen tension. Comparative studies of T. whipplei isolated from different anatomical sites (intestinal tissue, cardiac valves, central nervous system) could reveal tissue-specific adaptations in ATP synthase expression or activity. The ATP synthase might also contribute to the transition between active infection and persistence states, modulating energy production according to environmental cues. Research methodologies should include tissue-specific infection models, comparison of T. whipplei proteomes across different host environments, and analysis of ATP synthase activity under conditions mimicking different host microenvironments. Understanding these adaptations could explain the diverse clinical manifestations of T. whipplei infection and the bacteria's ability to persist despite apparent immunocompetence in some carriers .

How does the evolutionary history of T. whipplei ATP synthase reflect its adaptation to an intracellular lifestyle?

The evolutionary history of T. whipplei ATP synthase offers insights into the adaptation of this organism to its intracellular lifestyle. Comparative genomic and proteomic analyses reveal that T. whipplei, with its reduced genome (808 predicted ORFs), has retained ATP synthase genes despite losing many other metabolic pathways . This retention suggests strong selective pressure to maintain energy production capacity through oxidative phosphorylation. Phylogenetic analysis of ATP synthase sequences across bacterial species, with particular focus on the transition from environmental to host-associated lifestyles, can reveal adaptive mutations that emerged during T. whipplei evolution. Molecular clock analyses might correlate changes in ATP synthase with the timing of adaptation to human hosts. Of particular interest would be comparing the ATP synthase of T. whipplei with those of related actinomycetes that have different lifestyles. Similar to how the GAPDH of T. whipplei shows homology with that of Listeria monocytogenes and may be involved in phagosome maturation interference, the ATP synthase might have acquired specialized functions during adaptation to intracellular life .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.