Recombinant Tropheryma whipplei DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Tropheryma whipplei DNA Translocase FtsK (ftsK)

Recombinant Tropheryma whipplei DNA translocase FtsK (ftsK) is a bacterial protein derived from the organism responsible for Whipple's disease, a rare systemic infection affecting multiple organ systems. FtsK belongs to a specialized class of molecular machines known as DNA translocases, which utilize ATP hydrolysis to power the movement of DNA molecules during critical cellular processes. The production of this protein in recombinant form has allowed researchers to study its properties outside the difficult-to-culture T. whipplei bacterium.

The recombinant T. whipplei FtsK protein is typically produced through heterologous expression in Escherichia coli, where the ftsK gene from T. whipplei is introduced into E. coli cells, enabling large-scale production of the protein for research and commercial applications . The recombinant protein is commonly engineered with affinity tags, such as an N-terminal histidine tag, to facilitate purification through immobilized metal affinity chromatography techniques . These purification approaches yield a highly pure protein product suitable for detailed biochemical and structural studies.

In its native context, FtsK serves as a critical component of the bacterial cell division machinery, participating in the final stages of chromosome segregation before cell separation. Its study not only advances our understanding of fundamental bacterial processes but also provides potential insights into novel therapeutic approaches against T. whipplei infections, which can be challenging to diagnose and treat effectively.

Quaternary Structure

Based on studies of FtsK proteins in bacteria, the T. whipplei FtsK forms a hexameric ring-like structure that encircles double-stranded DNA . This quaternary arrangement creates a central channel through which DNA passes during translocation. The hexameric assembly is critical for the protein's function as a molecular motor, with each subunit contributing to the coordinated movement of DNA through ATP binding and hydrolysis cycles.

The motor portion of FtsK is further subdivided into three domains designated α, β, and γ . The α and β subdomains contain RecA-like nucleotide-binding/hydrolysis folds and form the hexameric ring structure with the central DNA channel, while the γ subdomain functions as a regulatory module that confers directionality to DNA translocation through interaction with specific DNA sequences .

Table 1: Key Structural Features of Recombinant T. whipplei FtsK

FeatureDescription
Protein Length741 amino acids (full-length)
Molecular WeightApproximately 82 kDa (monomer)
Expression SourceE. coli
Purification TagN-terminal His-tag
DomainsN-terminal membrane-associated domain, central motor domain (α, β, γ), C-terminal regulatory domain
Quaternary StructureHexameric ring with central DNA channel
Physical FormLyophilized powder (commercial preparations)

The structural organization of T. whipplei FtsK reflects its specialized function as a DNA motor protein, with features conserved across bacterial species but also likely containing unique adaptations specific to T. whipplei's biology and lifecycle.

Functional Mechanisms of FtsK in T. whipplei

The FtsK protein in Tropheryma whipplei operates as a sophisticated molecular machine with multiple functions critical to bacterial cell division and chromosome maintenance. Understanding these mechanisms provides insight into both fundamental bacterial processes and the specific biology of this human pathogen.

DNA Translocation Activity

The primary function of FtsK is to act as a DNA motor protein, using energy from ATP hydrolysis to power the movement of DNA molecules. Studies on FtsK proteins have revealed that they can translocate DNA at remarkable speeds, approaching 5000 base pairs per second . This rapid movement is generated through coordinated conformational changes in the hexameric protein complex as ATP is bound and hydrolyzed.

The translocation mechanism involves several key steps:

  1. Binding of the FtsK hexamer to double-stranded DNA

  2. ATP binding to the motor domains

  3. Conformational changes that drive DNA movement through the central channel

  4. ATP hydrolysis and release

  5. Return to the initial state, completing one cycle of the motor action

This process occurs with sufficient force to displace other proteins bound to the DNA, making FtsK an exceptionally powerful molecular motor .

Role in Chromosome Segregation

In the context of bacterial cell division, FtsK serves as a critical component of the chromosome segregation machinery. During the final stages of chromosome replication and segregation, FtsK helps ensure that chromosomal DNA is properly distributed to daughter cells before cell division completes .

FtsK is localized to the bacterial division septum, where it assembles along with other cell division proteins (FtsZ, FtsA, FtsQ, FtsL, FtsI, FtsN, and FtsW) in a specific sequence during septum formation . The N-terminal domain of FtsK anchors the protein to the membrane at the septum, while the C-terminal motor domain extends into the cytoplasm where it can interact with chromosomal DNA .

As the septum closes during cell division, FtsK acts as a DNA pump, actively translocating any DNA trapped at the division site to ensure complete chromosome segregation before cells separate . This mechanism helps prevent chromosome breakage and genetic loss during cell division.

XerCD Recombination Activation

A particularly important function of FtsK is its role in resolving chromosome dimers that can form through homologous recombination between sister chromosomes during replication. If left unresolved, these dimers can prevent proper chromosome segregation and lead to cell death .

FtsK activates the XerCD site-specific recombination system that acts at a specific 28-bp sequence called the dif site, located in the chromosome terminus region . The motor activity of FtsK translocates DNA until it reaches the dif site, where it interacts with the XerCD recombinases to switch their catalytic state . This activation allows XerD to perform the first pair of strand exchanges to form Holliday junctions, which are then resolved by XerC, completing the recombination process that converts chromosome dimers to monomers .

This recombination process is crucial for proper chromosome segregation, as evidenced by studies showing that approximately 15% of all cells undergo recombination between sister strands during replication, potentially leading to chromosome dimers that must be resolved .

Directional DNA Movement

The directional movement of FtsK is guided by specific DNA sequences called KOPS (FtsK-Orienting Polar Sequences), typically 8-bp motifs with the consensus sequence 5'-GGGNAGGG-3' . These sequences are distributed throughout the bacterial chromosome with a bias in orientation that directs FtsK movement toward the terminus region where the dif site is located .

The γ domain of FtsK recognizes these KOPS sequences, ensuring that the motor is loaded onto DNA in the correct orientation so that subsequent translocation moves chromosomal DNA in the appropriate direction . This directional control mechanism is essential for efficient chromosome segregation and dimer resolution.

Production and Properties of Recombinant T. whipplei FtsK

The recombinant production of T. whipplei FtsK has been crucial for studying this protein, as T. whipplei itself is difficult to culture and grows fastidiously only in cell cultures without plaque production . Commercial production and academic research have established effective methods for generating this protein in heterologous expression systems.

Expression and Purification

Recombinant T. whipplei FtsK is typically produced using E. coli expression systems . The gene encoding the full-length protein (1-741 amino acids) is cloned into appropriate expression vectors and introduced into E. coli host cells. Expression is induced under controlled conditions to maximize protein yield while maintaining proper folding and activity.

The recombinant protein is commonly engineered with an N-terminal histidine tag, which facilitates purification through immobilized metal affinity chromatography (IMAC) . Following initial capture through IMAC, additional chromatography steps may be employed to achieve high purity, typically greater than 90% as determined by SDS-PAGE analysis .

Physical and Biochemical Properties

Commercial preparations of recombinant T. whipplei FtsK are available in lyophilized powder form, which enhances stability during shipping and storage . The protein is typically formulated in a buffer containing stabilizers such as trehalose to maintain its integrity in the dried state .

Table 2: Properties of Commercial Recombinant T. whipplei FtsK Preparations

PropertySpecification
Expression HostE. coli
Protein LengthFull length (1-741 amino acids)
Purification TagN-terminal His tag
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL concentration
Long-term StorageAddition of 5-50% glycerol recommended for aliquots

For research applications, the lyophilized protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol (typically to a final concentration of 50%) is recommended for long-term storage of reconstituted protein to prevent freeze-thaw damage .

Handling and Stability Considerations

Proper handling of recombinant T. whipplei FtsK is crucial for maintaining its activity and structural integrity. Manufacturers recommend brief centrifugation of vials prior to opening to ensure the lyophilized protein is collected at the bottom of the container .

Once reconstituted, the protein should be stored at 4°C for short-term use (up to one week) or aliquoted and stored at -20°C or -80°C for long-term storage . Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity .

The stability of the protein can be affected by buffer conditions, with optimal stability typically achieved in Tris or phosphate-based buffers at pH 7.5-8.0 . The addition of stabilizers such as glycerol or trehalose helps maintain protein integrity during storage and handling.

Applications in Research and Biotechnology

Recombinant T. whipplei FtsK has proven to be a valuable tool in various research and biotechnology applications, offering insights into bacterial biology and potential therapeutic approaches for Whipple's disease.

Fundamental Research on DNA Motors

As a powerful DNA motor protein, recombinant FtsK provides an excellent model system for studying the mechanisms of ATP-driven DNA translocation. In vitro studies using purified recombinant FtsK have enabled detailed characterization of its motor properties, including translocation rates, directional control, and force generation capabilities .

These studies contribute to our understanding of how molecular motors convert chemical energy from ATP hydrolysis into mechanical work, a fundamental process in biology. The exceptional speed and power of FtsK (approximately 5000 bp per second) make it particularly interesting as a model for understanding high-efficiency biological motors .

Chromosome Segregation Studies

Recombinant T. whipplei FtsK has been instrumental in elucidating the mechanisms of bacterial chromosome segregation. Through in vitro reconstitution experiments, researchers can study how FtsK interacts with DNA and other proteins involved in chromosome partitioning .

These studies have revealed the critical role of FtsK in resolving chromosome dimers through activation of XerCD-mediated site-specific recombination at the dif site . Understanding these processes provides insight into how bacteria ensure faithful transmission of genetic material to daughter cells during division.

Antibiotic Development Research

As an essential protein in bacterial cell division, FtsK represents a potential target for novel antibiotics. The availability of purified recombinant T. whipplei FtsK enables high-throughput screening of compound libraries to identify molecules that specifically inhibit its motor activity or interaction with other division proteins.

This approach is particularly relevant for developing treatments for Whipple's disease, caused by T. whipplei infection, which can be challenging to treat effectively. Studies have already investigated the susceptibility of T. whipplei to various antibiotics, including fluoroquinolones, which target type II topoisomerases that, like FtsK, interact with DNA .

Diagnostic Applications

Recombinant T. whipplei proteins, including FtsK, can serve as antigens for developing diagnostic tools for Whipple's disease. Antibodies raised against purified recombinant FtsK could be used in immunoassays to detect T. whipplei in clinical samples, potentially improving the specificity and sensitivity of diagnostic tests.

Additionally, the amino acid sequence of FtsK contains regions that may be unique to T. whipplei, providing potential targets for species-specific diagnostic approaches based on antibody recognition or PCR amplification.

Table 3: Research Applications of Recombinant T. whipplei FtsK

Application AreaSpecific UsesRelevance
DNA Motor StudiesIn vitro translocation assays, ATP hydrolysis measurementsUnderstanding molecular motor mechanisms
Chromosome BiologyXerCD recombination activation, dimer resolution studiesInsights into bacterial genome maintenance
Structural BiologyX-ray crystallography, cryo-electron microscopyDetermination of protein structure and mechanism
Drug DiscoveryHigh-throughput screening, structure-based drug designDevelopment of novel antibiotics
Diagnostic ToolsAntibody production, immunoassay developmentImproved detection of T. whipplei infection
Molecular ToolsDNA manipulation, in vitro recombination systemsBiotechnology applications

Current Research and Future Directions

Research on T. whipplei FtsK continues to evolve, with several promising directions for future investigation that may enhance our understanding of bacterial cell division and disease mechanisms.

Comparative Genomic Studies

Recent comparative genomic analyses of T. whipplei strains have provided insights into the diversity and evolution of this organism . These studies reveal specific genomic regions that differ between strains, potentially including variations in cell division proteins like FtsK that might affect bacterial fitness or pathogenicity.

The identification of both gyrA and parC genes in T. whipplei, encoding the alpha subunits of DNA gyrase and topoisomerase IV (natural fluoroquinolone targets), represents a significant finding . The detection of parC in T. whipplei was particularly noteworthy as this was the first time this gene had been identified in actinobacteria . Future research may explore potential interactions between these topoisomerases and FtsK during chromosome replication and segregation.

Structure-Function Relationships

Despite advances in understanding FtsK function, many questions remain about the structural basis of its motor activity and regulation. Future structural studies, including high-resolution crystallography or cryo-electron microscopy of T. whipplei FtsK, could provide detailed insights into how this molecular machine operates.

Of particular interest is understanding how the different domains of FtsK coordinate their activities, how ATP binding and hydrolysis drive conformational changes that power DNA movement, and how the protein recognizes specific DNA sequences to guide its directional movement.

Therapeutic Targeting

As antibiotic resistance continues to pose challenges in treating bacterial infections, novel targets like FtsK offer potential avenues for developing new antimicrobial agents. Future research might focus on:

  1. Identifying small molecules that specifically inhibit T. whipplei FtsK activity

  2. Developing peptide inhibitors that disrupt FtsK interactions with other division proteins

  3. Exploring combination therapies that target multiple components of the bacterial division machinery

Studies have shown that T. whipplei has specific fluoroquinolone susceptibility profiles correlated with amino acid sequences in its topoisomerase targets . Similar approaches could be applied to FtsK, identifying sequence features that might confer differential susceptibility to potential inhibitors.

Single-Molecule Studies

Advanced biophysical techniques, including single-molecule fluorescence and force spectroscopy, offer powerful approaches for studying molecular motors like FtsK. Future studies employing these techniques could provide unprecedented insights into the dynamics and mechanics of FtsK-mediated DNA translocation.

These approaches could address questions about the step size of the motor, the coordination between subunits in the hexamer, the force generated during translocation, and how the motor responds to obstacles or varying DNA sequences.

In Vivo Dynamics

While in vitro studies with recombinant protein have provided valuable insights, understanding the dynamics of FtsK in living T. whipplei cells remains challenging due to difficulties in culturing and manipulating this organism. Development of improved cell culture systems or fluorescent protein tagging approaches could enable real-time visualization of FtsK localization and activity during T. whipplei cell division.

Such studies would bridge the gap between biochemical findings with recombinant protein and the physiological role of FtsK in bacterial cell biology, potentially revealing new aspects of its function and regulation in the context of infection.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ftsK; TW631; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-741
Protein Length
full length protein
Species
Tropheryma whipplei (strain TW08/27) (Whipple's bacillus)
Target Names
ftsK
Target Protein Sequence
MSAKKSYLKVWRGLAGAAGSCARVFSKKSLARRDRRDQLPFALFLFGLVGAVFQWFLYGN WLSGIVSEYTVAAFFGGFSIVLPILLIGFSIWLFRNPQKTHDNIRVSIGLFMFSSFSAAF LHFSAGFPYPSSGIRILSTAGGIIGWLVGLPLTTLPSYLAKTVCIIFIVLSVSVISKTPI SKIVRVIFRYAKWLFNSDSVKTSPNSSVSSSSEHQELTGRDMPDTAGDNRHDETVTVLSG TSLTGSPVSEYRGESSDYALPSLDILNSYPPVKHDDAENEKVITALSGVLRQFSVNARFS GFSRGPTVTQYELELGEGVKVERIIALTKNISYAVASDKVSILSPIPGKSAIGIEIPNKK RELVALGSVLQSIHPDAHPMTVGLGKDSSGGFVLTNLTTMPHLLVAGATGSGKSSFVNSM ITSILLRAHPSQVRLVLIDPKRVELAIYSGVPHLITPIVTDPKKASEVLQWVVKEMERRY DDLASFGFRHIDDFNLAVRAKKIASDSRELTPYPYLLVIVDELADLMLVAAKDVEESIVR ITQLARASGIHIVLATQRPSVNVVTGLIKANVPSRLAFAVSSLVDSRVILDRPGAEKLVG QGDGLFLPISAGKPIRIQSSWVTENEILRVVEYVKSQAHPDYYVLEVQNQGNIDSHIGDD MPLLLKATELVINSQLGSTSMLQRKLRVGFAKAGRLMDLMESMGIVGPGQGSKAREVLVT PQDLDSTLARISASVSDSKLD
Uniprot No.

Target Background

Function
This protein is crucial for cell division. It coordinates cell division and chromosome segregation. The N-terminus plays a role in assembling the cell division machinery. The C-terminus functions as a DNA motor that moves double-stranded DNA (dsDNA) in an ATP-dependent manner towards the dif recombination site, located within the replication terminus region. This protein is essential for activating the Xer recombinase, facilitating chromosome unlinking through recombination.
Database Links

KEGG: tws:TW631

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is DNA translocase FtsK and what is its role in T. whipplei?

FtsK is a specialized DNA motor protein that coordinates chromosome segregation and cell division in bacteria, including Tropheryma whipplei. It functions as a DNA translocase, capable of rapidly and directionally moving double-stranded DNA (dsDNA). One of its primary roles is to activate XerCD site-specific recombination, which is essential for resolving chromosome dimers that form during replication. In the bacterial life cycle, FtsK ensures proper chromosome segregation before cell division completes, thereby maintaining genomic integrity across generations .

Unlike many other bacterial proteins, T. whipplei FtsK operates in the context of this organism's highly reduced genome (approximately 0.92 Mb), reflecting its evolutionary adaptation as an obligate intracellular pathogen . The protein's function is particularly significant given that T. whipplei has undergone substantial genome reduction while maintaining essential chromosome management systems.

How does the structure of FtsK relate to its function?

FtsK adopts a complex quaternary structure that directly enables its DNA translocation activity. Crystal structure analyses reveal that FtsK assembles into a hexameric ring with a large central annulus through which double-stranded DNA passes. Each FtsK monomer contains a RecA-like core, which is characteristic of many nucleic acid motor proteins. The hexameric assembly can further organize into a dodecamer consisting of two hexamers arranged head-to-head .

Electron microscopy studies confirm this arrangement, demonstrating that the hexameric structure forms in a DNA-dependent manner in solution. This structural organization allows FtsK to encircle DNA while providing multiple ATP-binding interfaces that power the translocation process. The central channel of the hexamer accommodates duplex DNA, orienting it optimally for directed movement .

What genomic features influence FtsK activity in T. whipplei?

The genomic context in which FtsK operates is particularly interesting in T. whipplei given the identification of a 19.2 kb deletion in certain strains, which represents a major hotspot for intra-specific differentiation . This region may influence the local chromatin environment in which FtsK functions, potentially affecting its recruitment or processivity.

What is the proposed mechanism for FtsK-mediated DNA translocation?

Based on structural studies comparing FtsK monomer conformations from different crystal forms, researchers have proposed a "rotary inchworm mechanism" for DNA translocation. This mechanism involves coordinated conformational changes within the hexameric assembly that progressively move DNA through the central channel .

The process begins with ATP binding inducing conformational changes in individual FtsK subunits. These changes alter the affinity of specific domains for DNA, creating a cycle of grip-and-release actions. As ATP is hydrolyzed, the protein's conformation resets, but only after advancing the DNA strand. The sequential action of the six subunits creates a continuous translocation movement, allowing FtsK to move DNA at remarkable speeds while maintaining processivity .

What distinguishes T. whipplei FtsK is its operation within the constraints of a highly specialized pathogen with limited genetic resources. Understanding how the mechanism may be optimized for efficiency in this context presents a frontier for current research.

How does the FtsK-XerCD system resolve chromosome dimers in T. whipplei?

The FtsK-XerCD system in T. whipplei likely functions similarly to the well-characterized system in E. coli, but with adaptations specific to T. whipplei's genome architecture. FtsK activates the XerCD recombinases at the dif site, which is located at the junction between the two polarized chromosome arms (replichores). This activation triggers site-specific recombination that resolves chromosome dimers formed during replication .

The process is subject to strict spatiotemporal control, occurring at the time of cell division and requiring precise positioning of the dif resolution site. FtsK appears to play dual roles in this system: first mobilizing the dif sites to the septum using a directional translocation mechanism, and then activating the XerCD recombination machinery .

The directionality of FtsK-mediated DNA movement is guided by genomic polarity, which is established by skewed sequence distributions across the chromosome. In T. whipplei, the specific sequence motifs that guide FtsK translocation direction remain to be fully characterized, offering an important research direction .

What insights do comparative genomic studies provide about FtsK conservation in T. whipplei strains?

Microarray-based comparative genomic hybridization studies of T. whipplei isolates reveal remarkably limited genetic variation among strains isolated from different geographical locations and biological sources. This high conservation rate (with at most 2.24% of probes showing differential hybridization) indicates that T. whipplei rarely exchanges genetic material with other organisms .

Additionally, a significant 19.2 kb deletion identified in the T. whipplei DIG15 strain occurs in the same region as a previously described genomic rearrangement between the Twist and TW08/27 strains. This region represents a hotspot for T. whipplei differentiation and may influence chromosome architecture in ways that impact FtsK function .

What expression systems are optimal for producing functional recombinant T. whipplei FtsK?

Temperature control during expression is particularly important, as FtsK is a large, multi-domain protein prone to misfolding and aggregation. Induction at lower temperatures (16-18°C) with reduced IPTG concentrations often yields higher proportions of soluble, active protein. For researchers seeking to study specific domains, expressing individual functional units (such as the motor domain) rather than the full-length protein may improve yield and stability .

What are the key considerations for designing in vitro assays to study T. whipplei FtsK activity?

When designing in vitro assays to study T. whipplei FtsK activity, researchers should consider the following methodological approaches:

  • DNA substrate selection: Using DNA substrates containing T. whipplei-specific sequence motifs that potentially guide FtsK directionality will provide more physiologically relevant results than random DNA sequences.

  • ATP hydrolysis assays: Measuring ATPase activity in the presence of different DNA substrates can reveal substrate preferences and requirements for activity. This can be accomplished using colorimetric phosphate detection methods or coupled enzyme assays.

  • DNA translocation assays: Several approaches can be used to directly measure DNA translocation:

    • Magnetic or optical tweezers to measure force generation during translocation

    • FRET-based assays using labeled DNA to detect movement

    • Triplex displacement assays to monitor translocation rates along specific DNA tracks

  • Single-molecule techniques: These provide insights into the dynamics of individual FtsK hexamers and can reveal mechanistic details obscured in bulk assays .

Control experiments should include ATP-binding deficient mutants and comparisons with FtsK proteins from well-characterized bacteria like E. coli to benchmark activity measurements.

How can researchers effectively purify active T. whipplei FtsK protein?

Purification of active T. whipplei FtsK requires a carefully designed protocol that preserves the protein's native structure and activity. A multi-step purification strategy is recommended:

  • Initial capture: Affinity chromatography using the incorporated tag (His6, GST, etc.) provides high selectivity in the initial purification step.

  • Intermediate purification: Ion exchange chromatography can separate different oligomeric states of FtsK and remove contaminants with similar affinity for the initial capture step.

  • Final polishing: Size exclusion chromatography is crucial for isolating homogeneous hexameric complexes and removing aggregates. This step should be performed in the presence of a non-hydrolyzable ATP analog (such as ATPγS) to stabilize the hexameric form.

Throughout purification, buffer composition is critical. Include:

  • 5-10% glycerol to improve stability

  • 1-5 mM MgCl₂ to support proper folding

  • Reducing agents (DTT or TCEP) to prevent oxidation of cysteine residues

  • Low concentrations (100-200 mM) of KCl or NaCl to maintain solubility without disrupting protein-protein interactions

Functional assays should be performed after each purification step to track activity retention and guide protocol optimization.

How should researchers analyze DNA translocation kinetics of T. whipplei FtsK?

Analysis of DNA translocation kinetics requires robust quantitative approaches to accurately capture the complex behavior of FtsK. When examining translocation data, researchers should consider the following analytical frameworks:

Statistical approaches should include:

  • Bootstrap resampling to generate confidence intervals for kinetic parameters

  • Hidden Markov modeling to identify distinct kinetic states

  • Dwell-time analysis to characterize pausing behavior

What genomic approaches can identify potential FtsK binding sites in the T. whipplei genome?

Identification of potential FtsK binding sites in the T. whipplei genome requires integrative bioinformatic analyses:

  • Sequence motif discovery: Tools like MEME, GLAM2, or DREME can identify over-represented motifs that may serve as FtsK recognition sequences. These should be applied to analyze skewed sequence distributions, particularly in the terminus region.

  • Comparative genomics: Alignment of multiple T. whipplei strains (such as Twist, TW08/27, and DIG15) can identify conserved non-coding sequences near the terminus region that may represent functional FtsK binding sites. This is particularly relevant given the 19.2 kb deletion observed in the DIG15 strain that may affect chromosome architecture .

  • GC skew analysis: Calculating GC skew [(G-C)/(G+C)] across the T. whipplei genome can identify the terminus region where FtsK activity is likely concentrated.

  • ChIP-seq validation: For experimental validation, chromatin immunoprecipitation followed by high-throughput sequencing can map actual FtsK binding sites genome-wide, providing ground truth for computational predictions.

Analytical ApproachPrimary ApplicationComputational ToolsValidation Method
Motif DiscoveryIdentify sequence patterns recognized by FtsKMEME, GLAM2, STREMEIn vitro binding assays
GC Skew AnalysisLocate terminus regionGenSkew, ArtemisWhole-genome sequencing
Comparative GenomicsIdentify conserved FtsK binding regionsMAUVE, ACT, RoaryTargeted mutagenesis
DNA Structural AnalysisPredict DNA deformability at FtsK sitesDNAshape, ORChIDEMSA, DNA footprinting

How can T. whipplei FtsK activity be assessed in the context of thermal stress response?

Assessing T. whipplei FtsK activity under thermal stress conditions provides insights into adaptation mechanisms of this pathogen. Transcriptome analysis of T. whipplei under thermal stresses reveals complex regulatory responses that may impact FtsK function . While FtsK itself was not among the most differentially expressed genes in the available studies, its activity is likely affected by thermal stress through various mechanisms:

  • Indirect effects through global transcriptional changes: Thermal stress (particularly cold shock at 4°C) induces significant transcriptional changes in T. whipplei, with 149 genes differentially transcribed. These include genes encoding membrane proteins and enzymes involved in fatty acid biosynthesis, suggesting membrane modifications that could affect membrane-associated processes like FtsK-mediated cell division .

  • Chaperone interaction: Heat shock proteins like GroEL2 are upregulated under cold stress in T. whipplei, which may impact FtsK folding and activity. The dnaK regulon, comprising six genes controlled by HspR-associated inverted repeats (HAIR motifs), is upregulated under heat stress (43°C) and may influence FtsK stability .

  • ATP availability: Thermal stress alters cellular energetics, potentially affecting ATP-dependent motor proteins like FtsK. Changes in ABC transporter expression observed during cold stress suggest altered nutrient uptake mechanisms that could influence cellular ATP levels .

To experimentally assess FtsK activity under thermal stress, researchers should combine transcriptomic approaches (RNA-seq or microarray) with functional assays that directly measure FtsK-dependent processes (chromosome segregation, XerCD recombination) under various temperature conditions.

What are the current gaps in understanding T. whipplei FtsK function compared to other bacterial species?

While significant progress has been made in understanding FtsK function in model organisms like E. coli, several knowledge gaps remain regarding T. whipplei FtsK:

  • The precise recognition sequences that guide T. whipplei FtsK directionality have not been fully characterized. Unlike E. coli, where KOPS motifs are well-defined, the specific sequences that orient FtsK movement in T. whipplei require further investigation .

  • The interaction between FtsK and the T. whipplei XerCD system needs detailed molecular characterization. Given T. whipplei's reduced genome, this interaction may show adaptations compared to model organisms .

  • The impact of the significant genomic rearrangements observed between T. whipplei strains (including the 19.2 kb deletion in DIG15) on FtsK function and chromosome management represents an important area for investigation .

  • How FtsK activity is regulated during T. whipplei's intracellular lifecycle remains poorly understood, particularly in the context of this pathogen's unique environmental adaptations and thermal stress responses .

These knowledge gaps present opportunities for researchers to make significant contributions to understanding the molecular biology of this clinically important but challenging-to-study pathogen.

How might recombinant T. whipplei FtsK be utilized in diagnostic applications?

While current diagnostic approaches for Whipple's disease focus on detecting T. whipplei DNA using PCR targeting conserved genes like hsp65 , recombinant FtsK could potentially enhance diagnostic capabilities:

  • Development of serological assays: Purified recombinant T. whipplei FtsK could be used to develop antibody-based detection methods, complementing current nucleic acid-based testing. This approach could be particularly valuable for cases where bacterial loads are below PCR detection thresholds.

  • Functional biomarkers: Given FtsK's essential role in chromosome management, assays detecting its activity could potentially distinguish between viable and non-viable bacteria, providing information about active infection versus past exposure.

  • Strain differentiation: The genomic region containing FtsK shows strain-specific variations, suggesting that FtsK-targeted approaches might enable strain typing, potentially correlating specific strains with clinical presentations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.