Recombinant Tropheryma whipplei Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Tropheryma whipplei Membrane Protein Insertase YidC (yidC)

Recombinant Tropheryma whipplei Membrane Protein Insertase YidC (UniProt ID: Q83MN6) is a genetically engineered protein produced to study the membrane integration mechanisms of bacterial proteins. YidC belongs to the conserved Oxa1/YidC/Alb3 family of insertases, which facilitate the folding and insertion of transmembrane proteins into lipid bilayers . In T. whipplei, the causative agent of Whipple’s disease, YidC is hypothesized to play a critical role in bacterial membrane biogenesis, though direct functional studies on this specific homolog remain limited .

2.1. Protein Architecture

The recombinant YidC from T. whipplei spans residues 1–310 and includes:

  • Five transmembrane domains (TMs): A conserved structural feature among YidC homologs, forming a hydrophilic groove for substrate interaction .

  • Cytoplasmic helical hairpin: Positioned between TM2 and TM3, critical for ribosome binding and co-translational insertion .

FeatureDetails
Molecular Weight~35 kDa (predicted for residues 1–310)
TagVariable (determined during production)
Storage BufferTris-based buffer, 50% glycerol
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

2.2. Mechanism of Action

YidC functions as a chaperone and insertase by:

  1. Recognizing hydrophobic regions of nascent membrane proteins .

  2. Facilitating transmembrane orientation via its hydrophilic cavity, shielding polar residues from the lipid bilayer .

  3. Accelerating folding of polytopic membrane proteins (e.g., melibiose permease) to prevent misfolding .

3.1. Recombinant Expression

  • Host System: Expressed in Escherichia coli with affinity tags (e.g., His-tag) for purification .

  • Purity: >90% as verified by SDS-PAGE .

3.2. Key Applications

ApplicationPurpose
ELISA and Antibody ProductionDetecting T. whipplei antigens in clinical samples .
Membrane Protein StudiesInvestigating YidC’s role in Sec-independent insertion mechanisms .
Structural BiologyModeling substrate interactions via molecular dynamics simulations .

Comparative Insights from YidC Homologs

Studies on E. coli YidC provide foundational insights applicable to T. whipplei:

  • Substrate specificity: YidC integrates single-spanning (e.g., Pf3 coat protein) and polytopic proteins (e.g., MelB) .

  • Catalytic efficiency: Each YidC molecule inserts ~150 substrate proteins, indicating enzymatic activity .

  • Collaboration with Sec translocase: YidC assists Sec-dependent substrates but operates independently for Sec-independent proteins .

Challenges and Future Directions

  • Functional gaps: Direct evidence of T. whipplei YidC’s role in pathogenicity is lacking. Current knowledge relies on homology with E. coli YidC .

  • Therapeutic potential: Targeting YidC could disrupt membrane biogenesis in T. whipplei, but inhibitors remain unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; TWT_805; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Tropheryma whipplei (strain Twist) (Whipple's bacillus)
Target Names
yidC
Target Protein Sequence
MFDGLFDFLQNILLPIKWVIEQILVFFHTLLGFLGFGDKSGLSWALSIVGLVIVIRATLI PVFLKQIRAQRKMLEIAPEVRRIQEKYKGKRDVLSRQSMNQEMMEIYRVRGANPLSSCLP IVLQMPVFFGLYQVIESAQNAGTGVGPLNGPLGMDFRDSRIFGVVPLHDSFSHDFYALQA GQAFNLITMIVAGVLTAIMIAVQLFTQLKVIPKNIPENAKNTSVYKNQKVMLYLLPIMFL GMGFSFPVGILIYWTASNVWSAVQQAVAIYRNPSPGSLAFELRRKRLGVQNKKTKGQRQQ PVNKRRAKRR
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It participates in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. It further assists in the folding of multispanning membrane proteins.
Database Links

KEGG: twh:TWT_805

STRING: 203267.TWT805

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of YidC in bacterial systems?

YidC functions as a membrane protein insertase that plays a critical role in inserting proteins into the plasma membrane of bacterial cells. It interacts directly with ribosomes during protein synthesis to facilitate co-translational membrane insertion of newly synthesized proteins. As proteins are produced by the ribosome, YidC helps guide them into the membrane at the precise exit point from the ribosome. This process is essential for proper membrane protein folding and assembly .

The protein acts both as a foldase and membrane integrase, assisting newly synthesized membrane proteins to achieve their proper three-dimensional conformation while simultaneously ensuring correct insertion into the lipid bilayer. This function is crucial for bacterial viability as membrane proteins perform essential cellular functions including transport, signaling, and structural support .

How does T. whipplei YidC differ from homologous proteins in other bacterial species?

T. whipplei YidC maintains the core functional domains present in other bacterial YidC homologs but has some distinct features. Unlike the E. coli homolog, the T. whipplei version lacks the non-conserved first transmembrane helix (TM1) present in some other bacterial species. Additionally, structural analysis reveals that while the membrane-integrated core structure is similar, the specific amino acid residues involved in stabilizing interactions differ .

What are the recommended storage and handling conditions for recombinant T. whipplei YidC protein?

For optimal stability and activity, recombinant T. whipplei YidC should be stored at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein. Repeated freeze-thaw cycles should be strictly avoided as they can compromise protein structure and function .

For routine experimental work, it is recommended to prepare working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw damage. When handling the protein, maintain sterile conditions and use appropriate low-protein binding tubes to prevent protein loss through adsorption. If dilution is necessary, use the same buffer composition as the storage buffer to maintain protein stability .

What experimental techniques have been most effective for studying YidC structure?

Multiple complementary approaches have proven effective for elucidating YidC structure:

  • Evolutionary Co-variation Analysis: This computational approach identifies pairs of residues that have co-evolved, suggesting spatial proximity in the folded protein. For T. whipplei YidC, this method successfully predicted seven helix-helix contacts with probabilities above 57%, while other potential contacts scored below 15% .

  • Molecular Dynamics (MD) Simulations: MD simulations have been instrumental in validating structural models and analyzing the stability of proposed configurations. These simulations revealed that while the five TM helices create a rigid protein core, the polar loop regions demonstrate mobility at the membrane surface .

  • Cryo-electron Microscopy: This technique has been used to visualize the YidC-ribosome complex, providing insights into how YidC interacts with ribosomes during co-translational membrane insertion .

  • In vivo Complementation Assays: Alanine mutants of key residues identified through structural predictions were tested for function through complementation assays, validating the functional importance of specific amino acids (e.g., T362 in TM2 and Y517 in TM6) .

The combination of these techniques has proven more powerful than any single approach for understanding YidC structure and function.

How can researchers accurately measure YidC-substrate protein interactions?

Measuring YidC-substrate interactions requires specialized techniques that can capture transient membrane protein associations. The following methodological approaches are recommended:

  • Site-specific Crosslinking: Using photoactivatable or chemical crosslinkers incorporated at specific positions within YidC to capture interactions with substrate proteins. This approach can identify contact points between YidC and its substrates during the insertion process.

  • FRET-based Assays: Fluorescence resonance energy transfer between labeled YidC and substrate proteins can provide real-time information about binding kinetics and conformational changes during the insertion process.

  • Ribosome Nascent Chain Complexes (RNCs): Creating stalled RNCs with the nascent substrate protein still attached to the ribosome allows for the study of co-translational interactions with YidC through techniques like cryo-EM.

  • Reconstituted Proteoliposome Systems: Purified YidC reconstituted into liposomes with defined lipid compositions provides a controlled environment for studying substrate interactions and insertion mechanisms.

The interaction analysis should account for the hydrophobic nature of both YidC and its substrates, requiring careful selection of detergents and buffer conditions to maintain native-like membrane environments .

How do specific amino acid residues contribute to YidC function and stability?

Molecular dynamics simulations and experimental validation have identified critical residues essential for YidC function:

RegionKey ResiduesFunctionEffect of Mutation
TM2T362Core stabilityComplete inactivation when mutated to alanine
TM6Y517Core stabilityComplete inactivation when mutated to alanine
TM CoreF433, M471, F505Structural integrityIntermediate activity levels when mutated
Cytoplasmic sidePolar/charged residuesElectrostatic/charge-dipole interactionsDisrupts core stability
Periplasmic sideAromatic residuesStacking and nonpolar dispersion interactionsAffects membrane association

The functional importance of T362 in TM2 and Y517 in TM6 has been definitively demonstrated through complementation assays. These residues are positioned at the same height in the membrane and are critical for YidC activity. Mutations of these residues to alanine completely inactivated YidC function without affecting protein stability, indicating their direct role in the insertion mechanism rather than merely maintaining structural integrity .

Hydrophobic residues on the exterior of the TM bundle interact with apolar lipid tails, stabilizing YidC in the membrane. The core is further stabilized by interactions between the five transmembrane helices, with distinct interaction patterns on the cytoplasmic versus periplasmic sides .

What is the molecular mechanism by which YidC facilitates membrane protein insertion?

The current model for YidC-mediated membrane protein insertion involves several coordinated steps:

  • Ribosome Docking: YidC interacts with the ribosome at the protein exit tunnel through specific binding sites identified on the cytoplasmic regions of YidC.

  • Substrate Recognition: As the nascent protein emerges from the ribosome, YidC recognizes specific features of membrane protein substrates, particularly hydrophobic transmembrane segments.

  • Hydrophilic Pore Formation: YidC is believed to form a partially hydrophilic pore or groove that shields the polar regions of substrate proteins from the hydrophobic membrane interior during insertion.

  • Lateral Release: After proper positioning, YidC facilitates the lateral release of the transmembrane segments into the lipid bilayer.

  • Folding Assistance: Beyond insertion, YidC assists in the proper folding of membrane proteins into their functional three-dimensional structures.

The helical arrangement of YidC's transmembrane domains creates a protected environment at the protein-lipid interface that accommodates substrate proteins during their transition from the aqueous environment of the ribosome exit tunnel to the hydrophobic membrane interior. This mechanism allows YidC to function without requiring an aqueous channel spanning the entire membrane .

How does membrane composition affect YidC structure and function?

Membrane composition significantly impacts YidC function through several mechanisms:

  • Lipid-Protein Interactions: MD simulations reveal specific interactions between YidC's external hydrophobic residues and membrane lipid tails. These interactions stabilize YidC in the membrane and may influence its conformational flexibility.

  • Membrane Thickness: YidC causes local membrane thinning, creating a region where the hydrophobic thickness of the membrane better matches the hydrophobic surface of substrate proteins, facilitating their insertion.

  • Charged Lipids: The bacterial membrane composition (typically 3 POPE to 1 POPG) provides a negatively charged environment that interacts with positively charged residues in YidC, properly orienting the protein and creating an electrostatic environment that aids in substrate insertion.

For experimental systems studying YidC function, maintaining a physiologically relevant lipid composition is critical. Researchers should consider using bacterial membrane mimetics with appropriate POPE:POPG ratios (3:1) when reconstituting YidC for functional studies .

What is the significance of YidC in T. whipplei pathogenesis and Whipple's disease?

While direct evidence linking YidC specifically to T. whipplei pathogenesis is limited, its essential role in membrane protein biogenesis suggests critical importance for bacterial survival and virulence. T. whipplei causes Whipple's disease, a rare infectious disorder that can be fatal if untreated. The bacterium replicates within macrophages in the intestinal mucosa, and proper membrane protein insertion through YidC is likely essential for establishing this intracellular niche .

T. whipplei has an extremely slow replication rate (even slower than Mycobacterium tuberculosis), with a doubling time estimated at 18 days. This slow growth likely depends on efficient membrane protein biogenesis mediated by YidC to maintain cellular functions during prolonged replication cycles. As membrane proteins often include virulence factors, transporters, and adhesins, YidC's function may directly impact pathogenic capabilities .

The unique features of T. whipplei YidC may represent adaptations to the bacterium's specialized lifestyle as an intracellular pathogen, potentially making it a target for therapeutics or diagnostics. Further research investigating substrate specificity of T. whipplei YidC compared to other bacterial homologs could reveal pathogen-specific functions relevant to disease progression .

How can recombinant T. whipplei YidC contribute to diagnostic methods for Whipple's disease?

Whipple's disease is notoriously difficult to diagnose due to nonspecific symptoms and challenges in cultivating T. whipplei. Recombinant T. whipplei YidC has potential applications in developing improved diagnostic methods:

  • Serological Assays: Purified recombinant YidC can be used as an antigen in ELISA or other immunoassays to detect anti-T. whipplei antibodies in patient sera. This approach could provide a less invasive alternative to current methods.

  • Protein Microarrays: YidC could be incorporated into protein microarrays alongside other T. whipplei antigens to create comprehensive diagnostic panels with improved sensitivity and specificity compared to single-antigen tests.

  • Molecular Detection Standards: Recombinant YidC or its encoding DNA can serve as positive controls in molecular detection methods, improving standardization of PCR-based diagnostics.

  • Structure-Based Antibody Development: The structural information derived from recombinant YidC studies can guide the development of monoclonal antibodies targeting accessible epitopes, potentially useful for immunohistochemical detection of T. whipplei in tissue samples.

While YidC is an intracellular protein and may not be the most accessible target for diagnostics, its high conservation and essential function make it a stable target less likely to be lost through mutation, potentially providing advantages over more variable surface antigens .

What challenges exist in studying T. whipplei proteins compared to other bacterial species?

Researchers face several unique challenges when studying T. whipplei proteins:

  • Cultivation Difficulties: T. whipplei has an extremely slow growth rate (doubling time of 18 days) and was only successfully cultured in 1997. This makes obtaining native protein extremely challenging and time-consuming .

  • Limited Genomic Information: Despite advances in sequencing, functional annotation of T. whipplei proteins remains incomplete, making it difficult to predict protein-protein interactions and functional networks involving YidC.

  • Post-translational Modifications: Potential pathogen-specific modifications may not be replicated in recombinant expression systems, potentially affecting protein function or antigenicity.

  • Intracellular Lifestyle: T. whipplei's adaptation to growth within macrophages means that proteins function in a unique environment that is difficult to replicate in vitro.

  • Clinical Sample Scarcity: The rarity of Whipple's disease means limited availability of clinical isolates for comparative studies of protein expression and function.

These challenges highlight the importance of recombinant protein approaches and computational methods for studying T. whipplei proteins like YidC. Heterologous expression systems provide access to proteins that would otherwise be extremely difficult to obtain in sufficient quantities for structural and functional studies .

How can the structural model of T. whipplei YidC inform antimicrobial development?

The detailed structural model of T. whipplei YidC provides several opportunities for antimicrobial development:

  • Structure-Based Drug Design: The identification of critical residues like T362 in TM2 and Y517 in TM6 provides potential binding sites for small molecule inhibitors. Compounds targeting these regions could disrupt YidC function and thereby inhibit bacterial growth.

  • Protein-Protein Interaction Inhibitors: Molecules that interfere with YidC-ribosome or YidC-substrate interactions could specifically disrupt membrane protein biogenesis. The mapped interaction surfaces identified through co-variation analysis and cryo-EM studies provide templates for designing such inhibitors.

  • Bacterial Selectivity: Comparative structural analysis between bacterial YidC and the human homolog (Oxa1L) can identify bacterial-specific features to target, potentially reducing toxicity to human cells.

  • Peptide Mimetics: Designing peptides that mimic YidC substrates but cannot be properly inserted could competitively inhibit the insertase function of YidC.

The essential nature of YidC across bacterial species suggests that targeting this protein could provide broad-spectrum activity, while structural differences between bacterial homologs might allow for species-specific targeting when desired .

What are the key experimental controls needed when working with recombinant T. whipplei YidC?

Robust experimental design for T. whipplei YidC research requires several critical controls:

Control TypePurposeImplementation
Expression VerificationConfirm protein identity and purityWestern blot with anti-YidC antibodies or anti-tag antibodies; mass spectrometry
Folding AssessmentVerify proper protein foldingCircular dichroism spectroscopy; limited proteolysis assays
Activity ControlsValidate functional activityComplementation assays in YidC-depleted bacterial strains
Negative ControlsControl for non-specific effectsInactive mutants (T362A or Y517A) as negative controls in functional assays
Species ComparisonEvaluate species-specific effectsParallel experiments with E. coli YidC or other bacterial homologs
Membrane IntegrationConfirm proper membrane insertionProtease protection assays; flotation assays with reconstituted proteoliposomes

Additionally, when performing structural studies or interaction analyses, controls should include proper detergent-only or lipid-only samples to account for background signals. For co-immunoprecipitation or crosslinking studies, controls using non-related membrane proteins help identify specific versus non-specific interactions .

What future research directions would advance our understanding of YidC function in T. whipplei?

Several promising research directions could significantly advance our understanding of T. whipplei YidC:

  • Substrate Specificity Profiling: Comprehensive identification of T. whipplei membrane proteins that depend on YidC for insertion would reveal pathogen-specific functions and potential virulence mechanisms.

  • High-Resolution Structure Determination: While computational models provide valuable insights, experimental structure determination through X-ray crystallography or cryo-EM would further refine our understanding of YidC mechanism.

  • Real-time Insertion Dynamics: Development of single-molecule techniques to visualize YidC-mediated insertion in real-time would provide unprecedented insights into the kinetics and conformational changes during substrate processing.

  • YidC-Associated Protein Networks: Identification of additional proteins that interact with YidC in T. whipplei could reveal accessory factors that contribute to its function in this slow-growing pathogen.

  • Conditional Depletion Systems: Development of genetic tools for conditional expression or depletion of YidC in T. whipplei would allow direct assessment of its essentiality and role during different stages of infection.

  • Comparative Genomics and Evolution: Analysis of YidC sequence and structural conservation across diverse bacterial species could reveal how this essential machinery has adapted to different bacterial lifestyles and membrane compositions.

These research directions would not only advance fundamental understanding of membrane protein biogenesis but could also contribute to new approaches for diagnosing and treating Whipple's disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.