Recombinant Tropheryma whipplei Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Tropheryma whipplei Prolipoprotein diacylglyceryl transferase (Lgt) is a bioengineered form of the bacterial enzyme responsible for modifying prolipoproteins by transferring diacylglyceryl groups. This protein plays a critical role in bacterial membrane biogenesis and is studied for its implications in pathogenesis, diagnostic development, and structural biology. Below is a detailed analysis of its biochemical properties, production methods, and research applications.

Biochemical Properties and Structure

Lgt belongs to the transferase family (EC 2.4.99.-) and catalyzes the transfer of sn-1,2-diacylglyceryl groups from phosphatidylglycerol to prolipoproteins, a process essential for bacterial membrane integrity. The T. whipplei Lgt is a partial recombinant protein (UniProt ID: Q820B8) with a predicted molecular weight corresponding to its N-terminal region (1–272 amino acids).

PropertyDetailsSource
Expression SystemsE. coli or yeast (S. cerevisiae)
Purity>85% (SDS-PAGE)
TagUndetermined during production (varies per batch)
SequenceMHFYIPPPPISGFWLGPLYVHMYSVFMLAGALVLFELTNRRFIVLTGNREFTAFAVTSLL...
Membrane TopologyHypothetical 7 transmembrane segments (based on E. coli Lgt studies)

Key Residues

Critical residues identified in E. coli Lgt include:

  • Y26, N146, G154: Essential for catalytic activity.

  • R143, E151, R239, E243: Important for substrate binding and enzyme stability .

Production and Handling

Recombinant Lgt is produced via heterologous expression in E. coli or yeast, with distinct protocols for each system:

ParameterE. coliYeast
Expression VectorUnspecified (likely pET-based)Unspecified
YieldNot reportedNot reported
Storage-20°C/-80°C (liquid: 6 months; lyophilized: 12 months)-20°C/-80°C (same as E. coli)
ReconstitutionDeionized water (0.1–1.0 mg/mL) + 5–50% glycerolSame as E. coli

Diagnostic Development

Lgt is not directly used in diagnostics but serves as a reference for understanding T. whipplei pathogenesis. PCR-based detection of T. whipplei DNA (e.g., targeting the 16S rRNA or repetitive sequences) is the gold standard for diagnosing Whipple’s disease .

Pathogenesis Studies

  • Glycoprotein Modification: T. whipplei surface glycoproteins interact with host galectins (Gal-1, Gal-3), which facilitate bacterial entry into macrophages .

  • Genome Plasticity: T. whipplei exhibits genome inversions mediated by repetitive surface protein (WiSP) gene clusters, potentially aiding immune evasion .

Challenges and Future Directions

  • Expression Limitations: Low yield and partial sequence production hinder functional studies.

  • Therapeutic Targets: Inhibiting Lgt or downstream glycosylation pathways may disrupt T. whipplei membrane stability or host-bacteria interactions .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Important Note: All of our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us and we will prioritize the development of the specified tag.
Synonyms
lgt; TWT_309; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Tropheryma whipplei (strain Twist) (Whipple's bacillus)
Target Names
lgt
Target Protein Sequence
MHFYIPPPPISGFWLGPLYVHMYSVFMLAGALVLFELTNRRFIVLTGNREFTAFAVTSLL IPVILGARLWHVVSHTQMYEHQPFYKVFAIWEGGLGFIGGVFSGLICFFVIAKIKKVPPF TFLDALAPGILAALCFARLGNYFNGEVFGTETTLPWGLKLSHEGFKDLNVEKYFHPIFLY EIILNVFIIVILLVLEKRVFVKTVFPKGSVFAAFLVLYGLGRFALEPMRYNLQQNSFGLD LNYVGAAAMIIVGVLIACRHTIASGKLRNSGD
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: twh:TWT_309

STRING: 203267.TWT309

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Tropheryma whipplei Prolipoprotein diacylglyceryl transferase (lgt)?

Tropheryma whipplei Prolipoprotein diacylglyceryl transferase (lgt) is an integral membrane enzyme involved in bacterial lipoprotein biogenesis. It catalyzes the first reaction in the three-step post-translational lipid modification process of bacterial lipoproteins. The enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to a cysteine residue in the lipobox sequence of prolipoproteins . In T. whipplei strain TW08/27 (Whipple's bacillus), this enzyme is encoded by the lgt gene and plays a critical role in bacterial survival and pathogenesis .

What is the role of lgt in T. whipplei pathogenesis?

Lgt plays a critical role in T. whipplei pathogenesis by enabling proper lipoprotein biogenesis, which is essential for bacterial survival. The lipid-modified proteins are important for maintenance of cell envelope architecture, transport, nutrient uptake, adhesion, and virulence . T. whipplei is the causative agent of Whipple disease, a chronic systemic infectious disease characterized by various clinical signs such as diarrhea, weight loss, lymphadenopathy, and polyarthritis . The bacterium has also been detected in bronchoalveolar lavage samples of patients with pneumonia, suggesting a potential role in respiratory infections . While the specific contribution of lgt to virulence is still being investigated, the essential nature of lipoprotein biogenesis for bacterial viability makes lgt a potential target for therapeutic intervention.

What methods are available for detecting T. whipplei in clinical samples?

Several methods have been developed for detecting T. whipplei in clinical samples:

  • PCR-based methods: Molecular detection using specific PCR assays targeting T. whipplei genes is highly sensitive for identifying the bacterium in various specimens including tissue samples and body fluids .

  • Metagenomic next-generation sequencing (mNGS): This advanced technology allows for unbiased detection of pathogens, including T. whipplei, directly from clinical samples. Recent studies have shown that mNGS can detect T. whipplei in bronchoalveolar lavage fluid (BALF) samples with higher sensitivity compared to traditional methods .

  • Histopathological examination: Traditional diagnosis of Whipple disease relies on histological examination of tissue samples, characterized by positive periodic acid-Schiff (PAS) stained inclusions within macrophages .

  • Electron microscopy: This technique can visualize the bacterium in infected tissues and has been historically important for establishing the microbiologic etiology of Whipple disease .

When specifically investigating lgt expression or function, researchers typically employ molecular biology techniques such as qRT-PCR for gene expression analysis or recombinant protein production for functional studies.

How can researchers accurately distinguish between colonization and pathogenic presence of T. whipplei?

Distinguishing between colonization and pathogenic presence of T. whipplei remains challenging and requires a comprehensive approach:

  • Quantitative assessment: Higher bacterial loads, as determined by quantitative PCR, may suggest active infection rather than colonization.

  • Multiple sampling sites: Detection in multiple tissues or body fluids, particularly in sterile sites, strongly supports pathogenic involvement.

  • Correlation with clinical symptoms: The presence of T. whipplei in conjunction with typical clinical manifestations of Whipple disease (gastrointestinal symptoms, arthralgia, neurological manifestations) suggests pathogenic involvement.

  • Histopathological evidence: Visualization of PAS-positive macrophages containing bacteria in affected tissues.

  • Response to antimicrobial therapy: Clinical improvement following targeted antibiotic treatment supports a pathogenic role.

  • Immunological response: Evaluation of host immune response markers can help differentiate between colonization and infection.

Research indicates that T. whipplei can be detected in saliva and stool samples of healthy individuals, suggesting it may exist as part of the normal microbiota in some cases . A retrospective study found T. whipplei in 4.0% (70/1725) of BALF samples, with many patients not displaying typical Whipple disease symptoms, suggesting potential colonization or subclinical infection .

What are the optimal conditions for expressing recombinant T. whipplei lgt?

Based on available research data and standard practices for membrane proteins similar to T. whipplei lgt, the following conditions are recommended:

  • Expression system: E. coli strains optimized for membrane protein expression (such as C41(DE3), C43(DE3), or Lemo21(DE3)) are preferred due to their ability to tolerate membrane protein overexpression.

  • Expression vector: Vectors with tightly controlled inducible promoters (such as pET or pBAD series) containing appropriate fusion tags for detection and purification.

  • Induction conditions:

    • Temperature: Lower temperatures (16-25°C) typically yield better results for membrane proteins

    • Inducer concentration: 0.1-0.5 mM IPTG for T7-based systems or 0.002-0.02% arabinose for araBAD promoter

    • Duration: Extended expression periods (16-24 hours) at lower temperatures

  • Solubilization: Extraction from membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), or lauryl maltose neopentyl glycol (LMNG).

  • Buffer optimization: Maintaining pH between 7-8 and including glycerol (10-20%) in buffers helps stabilize the protein.

For functional studies, it's crucial to confirm that the recombinant protein retains enzymatic activity using appropriate assays that measure diacylglyceryl transferase activity.

What functional assays can be used to assess T. whipplei lgt activity?

Several functional assays can be employed to assess the enzymatic activity of T. whipplei lgt:

  • In vitro diacylglyceryl transfer assay: This assay measures the transfer of a diacylglyceryl moiety from phosphatidylglycerol to a synthetic lipobox-containing peptide substrate. The reaction can be monitored using:

    • Radiolabeled lipid substrates and thin-layer chromatography

    • Mass spectrometry to detect modified peptides

    • Fluorescence-based assays with labeled substrates

  • GFP-based in vitro assay: Similar to methods used with E. coli Lgt, a GFP-lipobox fusion protein can serve as a substrate, with lipid modification causing changes in protein mobility on SDS-PAGE or alterations in membrane association .

  • Complementation assays: As demonstrated with E. coli Lgt, functional activity can be assessed by complementation of lgt-knockout cells with T. whipplei lgt variants. Successful complementation indicates functional enzyme activity .

  • Inhibition studies: Testing potential inhibitors (such as palmitic acid known to inhibit E. coli Lgt) can provide insights into enzymatic mechanism and active site architecture .

When designing these assays, researchers should consider the membrane-bound nature of lgt and ensure appropriate detergent conditions are maintained to preserve enzyme structure and function.

How does the structure of T. whipplei lgt compare to that of other bacterial species?

While the crystal structure of T. whipplei lgt has not been specifically reported in the provided search results, we can draw comparisons based on the available structural data for E. coli Lgt:

  • Conservation of catalytic residues: Analysis of the T. whipplei lgt sequence suggests conservation of key catalytic residues identified in E. coli Lgt, particularly the essential arginine residues (such as Arg143 and Arg239 in E. coli) that are critical for diacylglyceryl transfer .

  • Membrane topology: Like E. coli Lgt, T. whipplei lgt is predicted to be an integral membrane protein with multiple transmembrane segments that create a substrate binding pocket within the membrane.

  • Substrate binding sites: Based on the E. coli structure, T. whipplei lgt likely contains two binding sites - one for the phospholipid substrate and another for the prolipoprotein acceptor .

  • Lateral access mechanism: The structural arrangements likely support a mechanism whereby substrate and lipid-modified product enter and leave the enzyme laterally relative to the lipid bilayer, similar to what has been observed in E. coli Lgt .

A detailed comparative structural analysis would require experimental determination of the T. whipplei lgt structure through X-ray crystallography or cryo-electron microscopy, which would provide valuable insights into species-specific features that might be exploited for targeted drug development.

What are the critical residues for T. whipplei lgt function based on structural homology?

Based on structural and functional studies of E. coli Lgt and sequence homology with T. whipplei lgt, several residues are likely critical for enzyme function:

  • Conserved arginine residues: In E. coli, Arg143 and Arg239 were shown to be essential for diacylglyceryl transfer through complementation studies with lgt-knockout cells . The corresponding arginines in T. whipplei lgt are likely equally important for catalysis.

  • Phospholipid binding residues: Residues that interact with the phosphatidylglycerol substrate, particularly those that coordinate the phosphate group.

  • Lipobox recognition residues: Amino acids involved in recognizing the specific sequence motif (lipobox) in prolipoproteins, typically containing the consensus sequence [LVI][ASTVI][GAS][C].

  • Membrane-embedded catalytic pocket: Residues lining the active site pocket where the diacylglyceryl transfer reaction occurs.

  • Conformational gates: Amino acids that regulate substrate entry and product exit through conformational changes.

Site-directed mutagenesis studies targeting these predicted critical residues in T. whipplei lgt, followed by functional assays, would be necessary to experimentally validate their importance and potentially identify species-specific functional determinants.

How might understanding T. whipplei lgt contribute to novel therapeutic strategies?

Understanding T. whipplei lgt structure and function could contribute to therapeutic strategies in several ways:

  • Target-based drug design: The crystal structure of bacterial Lgt, such as that determined for E. coli, provides a template for structure-based design of specific inhibitors that could disrupt lipoprotein biogenesis in T. whipplei . Since Lgt is essential for viability in most Gram-negative bacteria, it represents an attractive antimicrobial target.

  • Broad-spectrum applications: Inhibitors designed based on conserved features of Lgt enzymes could potentially have activity against multiple bacterial pathogens, including T. whipplei.

  • Biomarker development: Understanding the enzyme's function could lead to improved diagnostic approaches that detect enzyme activity or products as biomarkers of infection.

  • Vaccine development: Lipoproteins processed by Lgt are often immunogenic and represent potential vaccine candidates. Understanding this processing pathway could inform vaccine design strategies.

  • Host-pathogen interaction studies: Lipoproteins modified by Lgt often play roles in host-pathogen interactions. Characterizing these relationships could reveal new therapeutic approaches targeting bacterial virulence rather than viability.

Given that deletion of the lgt gene is lethal to most Gram-negative bacteria, inhibitors of T. whipplei lgt could potentially be effective antimicrobial agents for treating Whipple disease and other T. whipplei-associated conditions .

What is the significance of T. whipplei detection in respiratory samples?

The detection of T. whipplei in respiratory samples has several significant implications:

  • Expanded disease associations: While T. whipplei is traditionally associated with Whipple disease affecting the gastrointestinal tract, its detection in bronchoalveolar lavage fluid (BALF) suggests a potential role in respiratory conditions .

  • Pneumonia etiology: Studies have detected T. whipplei DNA in 3-4% of BALF samples from patients with pneumonia, suggesting it should be investigated as a potential etiologic agent .

  • Novel genotypes: Research has identified novel genotypes of T. whipplei in respiratory samples, indicating genetic diversity that may correlate with different clinical manifestations or tissue tropism .

  • Asymptomatic carriage: Some patients with T. whipplei in BALF show minimal inflammation or symptoms, suggesting possible asymptomatic carriage or colonization in the respiratory tract .

  • Co-infection patterns: In many cases, T. whipplei is found alongside other pathogens, particularly Mycobacterium tuberculosis complex, raising questions about potential interactions between these microorganisms .

  • Non-immunocompromised hosts: Contrary to previous beliefs, T. whipplei has been detected in respiratory samples from non-immunocompromised patients, challenging the assumption that it primarily affects immunodeficient individuals .

The significance of detecting T. whipplei lgt specifically would lie in understanding the functional role of this enzyme in the bacterium's adaptation to the respiratory environment and its potential contribution to pathogenesis.

What approaches can be used to study T. whipplei lgt in the context of host-pathogen interactions?

To study T. whipplei lgt in host-pathogen interactions, researchers can employ several sophisticated approaches:

  • Cell culture infection models:

    • Human macrophage cell lines or primary cells can be infected with T. whipplei strains expressing wild-type or mutant lgt

    • Differential gene expression analysis can identify host response patterns specific to lgt-dependent bacterial factors

    • Confocal microscopy can visualize interactions between lipidated bacterial proteins and host cell components

  • Conditional expression systems:

    • Inducible lgt expression systems allow for temporal control of enzyme activity during infection

    • This enables study of specific stages of host-pathogen interaction dependent on lipoprotein modification

  • Lipoproteomic analysis:

    • Mass spectrometry-based approaches can identify the complete set of lipoproteins dependent on lgt activity

    • Comparative lipoproteomics between wild-type and lgt-deficient strains can reveal the specific bacterial factors involved in host interaction

  • CRISPR-Cas9 screening:

    • Genome-wide host factor screens can identify host proteins that interact with lgt-modified bacterial lipoproteins

    • This approach can reveal novel host pathways involved in recognizing or responding to T. whipplei lipoproteins

  • Ex vivo tissue models:

    • Intestinal or respiratory tissue explants can be used to study lgt-dependent processes in a more physiologically relevant context

    • Organoid models can provide insights into tissue-specific interactions

These approaches could help elucidate how lgt-modified lipoproteins contribute to T. whipplei's ability to establish infection in different tissues and potentially explain its association with diverse clinical manifestations.

How can researchers address the challenges of working with T. whipplei given its slow growth and specialized culture requirements?

Working with T. whipplei presents significant challenges due to its slow growth and fastidious nature. Researchers can address these challenges through several strategies:

  • Heterologous expression systems:

    • Express T. whipplei lgt in more tractable bacterial hosts like E. coli for biochemical and structural studies

    • Use surrogate systems to study enzyme function, such as complementation of lgt-deficient E. coli with T. whipplei lgt

  • Cell-free protein synthesis:

    • Utilize cell-free expression systems optimized for membrane proteins to produce T. whipplei lgt without the need for bacterial culture

    • This approach allows for rapid production and functional testing of variants

  • Synthetic biology approaches:

    • Construct minimal genetic systems containing T. whipplei lgt and essential components for functional analysis

    • Engineer reporter systems linked to lgt activity for high-throughput screening

  • Computational modeling and simulation:

    • Develop in silico models of T. whipplei lgt based on homology with structurally characterized Lgt proteins

    • Use molecular dynamics simulations to predict functional properties and substrate interactions

  • Molecular detection alternatives:

    • For clinical studies, utilize metagenomic next-generation sequencing (mNGS) and specific PCR assays to detect and study T. whipplei directly in clinical samples without cultivation

    • These approaches can provide valuable epidemiological and genetic data without requiring viable organisms

  • Co-culture systems:

    • Develop optimized co-culture methods with supporting cell types that enhance T. whipplei growth

    • Establish defined media conditions that better support the metabolic requirements of this fastidious organism

These strategies can help overcome the practical limitations of working with T. whipplei while still generating valuable insights into lgt function and its role in bacterial physiology and pathogenesis.

What are the comparative differences in lgt enzymatic efficiency between T. whipplei and other bacterial species?

While specific comparative enzymatic efficiency data for T. whipplei lgt versus other bacterial species is not directly available in the search results, researchers can investigate these differences through several approaches:

  • Enzyme kinetics comparison:

    • Determine and compare kinetic parameters (Km, kcat, catalytic efficiency) for purified lgt enzymes from different bacterial species using standardized substrates

    • Evaluate substrate preference and specificity across bacterial species

  • Substrate range analysis:

    • Compare the ability of lgt from different species to modify various lipobox-containing peptides

    • Identify species-specific differences in substrate recognition

  • Inhibitor sensitivity profiles:

    • Compare the sensitivity of lgt enzymes to known inhibitors (such as palmitic acid for E. coli Lgt)

    • Develop and test novel inhibitors against lgt from multiple species to identify differential sensitivity

  • Temperature and pH optima:

    • Determine optimal reaction conditions for lgt enzymes from different species

    • These differences may reflect adaptation to different host environments or ecological niches

  • Structural basis for efficiency differences:

    • Compare crystal structures or homology models to identify species-specific variations in the active site architecture

    • Correlate structural differences with enzymatic parameters

A comparative analysis table could be generated once experimental data is collected:

SpeciesKm (μM)kcat (min⁻¹)kcat/Km (M⁻¹·s⁻¹)pH optimumTemperature optimum (°C)Notable structural features
T. whipplei[Data pending][Data pending][Data pending][Data pending][Data pending][Data pending]
E. coli[Data pending][Data pending][Data pending][Data pending][Data pending]Two binding sites; inhibited by palmitic acid
[Other species][Data pending][Data pending][Data pending][Data pending][Data pending][Data pending]

This type of comparative analysis would provide valuable insights into evolutionary adaptations of lgt enzymes and could inform species-specific targeting strategies.

What emerging technologies might advance our understanding of T. whipplei lgt?

Several emerging technologies hold promise for advancing our understanding of T. whipplei lgt:

  • Cryo-electron microscopy:

    • High-resolution structural determination of membrane proteins without crystallization

    • Potential to visualize lgt in different conformational states during catalysis

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes to understand lgt interactions with other components of the lipoprotein biogenesis machinery

    • Identification of lipid-protein and protein-protein interactions

  • Single-molecule enzymology:

    • Real-time observation of individual lgt enzyme molecules during catalysis

    • Insights into reaction mechanism and conformational dynamics

  • Microfluidic platforms:

    • High-throughput screening of substrate specificity and inhibitor sensitivity

    • Miniaturized assay systems requiring minimal amounts of enzyme and substrates

  • Artificial intelligence and machine learning:

    • Prediction of substrate specificity based on lipobox sequence variations

    • Virtual screening for novel inhibitors targeting T. whipplei lgt

  • CRISPR-based genetic tools:

    • Development of genetic manipulation systems for T. whipplei

    • Creation of conditional mutants to study lgt essentiality and function in vivo

  • Metagenomic functional profiling:

    • Direct analysis of T. whipplei lgt activity in clinical samples without cultivation

    • Correlation of enzyme variants with disease manifestations

These technologies could help overcome current limitations in studying T. whipplei lgt and provide novel insights into its role in bacterial physiology and pathogenesis.

What are the unresolved questions regarding T. whipplei lgt that warrant further investigation?

Several critical questions about T. whipplei lgt remain unresolved and warrant further investigation:

  • Structural determinants of specificity:

    • What structural features determine substrate specificity of T. whipplei lgt?

    • How does the enzyme architecture differ from that of other bacterial species?

  • Role in tissue tropism:

    • Does lgt activity contribute to T. whipplei's ability to infect different tissues (intestinal, respiratory, neurological)?

    • Are there tissue-specific lipoproteins that depend on lgt activity?

  • Host immune recognition:

    • How do lgt-modified lipoproteins interact with host immune receptors?

    • Do these interactions contribute to chronic inflammation or immune evasion?

  • Essential nature:

    • Is lgt truly essential for T. whipplei survival as it is for most Gram-negative bacteria?

    • Could conditional mutants reveal growth conditions where lgt is dispensable?

  • Regulatory mechanisms:

    • How is lgt expression regulated in T. whipplei?

    • Does the bacterium modulate lgt activity in response to environmental conditions?

  • Inhibitor development:

    • Can species-specific inhibitors be developed that target T. whipplei lgt while sparing beneficial microbiota?

    • What chemical scaffolds show the most promise for inhibitor development?

  • Evolutionary considerations:

    • How has T. whipplei lgt evolved compared to other bacterial species?

    • Are there unique adaptations that reflect its specialized ecological niche?

  • Clinical correlations:

    • Do variations in lgt structure or activity correlate with different clinical manifestations?

    • Could lgt activity serve as a biomarker for disease progression or treatment response?

Addressing these questions would significantly advance our understanding of T. whipplei pathogenesis and potentially inform new diagnostic and therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.