Recombinant Tropidolaemus wagleri NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Function

MT-ND4 (NADH-ubiquinone oxidoreductase chain 4) is encoded by the mitochondrial MT-ND4 gene. It serves as a core subunit of Complex I, which catalyzes electron transfer from NADH to ubiquinone, initiating the proton gradient essential for ATP synthesis .

Key Functional AttributesDetails
Biological RoleElectron transport in mitochondrial oxidative phosphorylation
Enzyme Commission (EC) NumberEC 1.6.5.3 (NADH:ubiquinone reductase activity)
Structural FeaturesContains 231 amino acids with conserved domains for electron transfer

Key Findings from Venomic Studies

  • Venom Association: T. wagleri venom is uniquely neurotoxic due to waglerin peptides, but MT-ND4 itself is unrelated to venom toxicity .

  • Conservation: Despite morphological differences between sexes, MT-ND4 remains conserved in T. wagleri, suggesting stable evolutionary pressure .

Comparative Insights

MT-ND4 sequences across species show high homology in functional domains:

SpeciesSequence HomologyUnique Features
Tropidolaemus wagleri100% (native)Optimized for E. coli expression
Rattus norvegicus (Rat)~85%Larger N-terminal region (P05508)
Caiman crocodilus~78%Divergent C-terminal residues

Challenges and Future Directions

  • Stability Issues: Requires glycerol-containing buffers to prevent aggregation .

  • Functional Studies: Further research is needed to elucidate its role in T. wagleri’s unique mitochondrial adaptations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Tropidolaemus wagleri (Wagler's pit viper) (Trimeresurus wagleri)
Target Names
Target Protein Sequence
PIAGSMVLAAILLKLGGYGIIRMMQILPTTKTDVFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSVSHMGLVVAAIIIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRVLI LTRGFHNILPMATTWWLLINLMNIATPPTINFTSELLIISALFNWCPTTMIMLGLSMLIT ASYSLHMFLSTQMGPTMLSSQTEPTHSREHLLMILHIIPLVLISMKPELVI
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), considered essential for catalytic activity. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. Ubiquinone is believed to be the immediate electron acceptor for this enzyme.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does the production of recombinant Tropidolaemus wagleri MT-ND4 differ from other recombinant proteins?

The production of recombinant MT-ND4 presents unique challenges due to its transmembrane nature. The available recombinant protein is produced using an in vitro E. coli expression system . Unlike many soluble proteins, MT-ND4 requires specialized approaches:

  • Expression optimization: The hydrophobic regions necessitate careful codon optimization and expression conditions to prevent protein aggregation and inclusion body formation.

  • Extraction protocols: Specialized detergent-based extraction methods are required to solubilize the protein from membranes while maintaining structural integrity.

  • Purification considerations: The recombinant protein is typically produced with an N-terminal 10xHis tag to facilitate purification through immobilized metal affinity chromatography (IMAC) .

  • Expression region: The protein is expressed as the full-length protein covering region 1-231 , which encompasses the functional domains necessary for electron transport activity.

What are the optimal storage conditions for maintaining MT-ND4 stability?

The stability of recombinant MT-ND4 is influenced by multiple factors including buffer composition, temperature, and physical handling. Based on available product information, the following storage guidelines are recommended:

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

  • Long-term storage: Store at -20°C, or for extended storage, conserve at -20°C or -80°C .

  • Buffer composition: The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein .

  • Handling precautions: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

  • Shelf life considerations: The liquid form typically has a shelf life of approximately 6 months at -20°C/-80°C, while the lyophilized form can maintain stability for up to 12 months at similar temperatures .

How does the MT-ND4 protein relate to the biology of Tropidolaemus wagleri?

Understanding MT-ND4 in the context of Tropidolaemus wagleri's biology requires consideration of this species' unique characteristics:

Tropidolaemus wagleri (Wagler's pit viper) is a venomous snake species found in Southeast Asia with remarkable sexual dimorphism. Adult females can grow to 92-100 cm, while males reach only about 52-60 cm . This substantial size difference may have implications for metabolic demands and mitochondrial function.

The species displays remarkable sexual dimorphism in coloration and patterns:

  • Juvenile snakes have green, slender bodies with white and red spots

  • Adult males retain juvenile coloration with white and red postocular stripes

  • Adult females develop black and yellow crossbars, black postocular stripes, and banded bellies

These physiological and morphological differences suggest potential variations in metabolic demands that could influence mitochondrial protein expression and function, including MT-ND4.

How can recombinant MT-ND4 be used for comparative mitochondrial studies across snake species?

Recombinant MT-ND4 from Tropidolaemus wagleri provides a valuable tool for comparative studies examining mitochondrial evolution and adaptation across snake species. Researchers can apply the following methodological approaches:

  • Sequence analysis: Compare the amino acid sequence of T. wagleri MT-ND4 with homologs from other snake species to identify conserved domains and species-specific variations. The 231-amino acid sequence serves as an excellent reference point.

  • Functional assays: Develop comparative enzyme kinetics studies examining NADH oxidation rates across recombinant MT-ND4 proteins from different snake species.

  • Structural biology approaches: Employ structural prediction and modeling to compare putative functional domains and transmembrane regions across pit viper species.

  • Evolutionary rate analysis: Examine the rate of molecular evolution in MT-ND4 sequences in relation to ecological adaptations, particularly focusing on species with different thermal preferences and metabolic demands.

  • Integration with physiological data: Correlate sequence variations with differences in metabolic rate, thermal tolerance, and habitat preferences among snake species.

What insights can MT-ND4 provide regarding energy metabolism in relation to venom production?

The energy demands of venom production in Tropidolaemus wagleri may be reflected in mitochondrial adaptations, with MT-ND4 potentially playing a key role in supporting this energetically expensive process.

Tropidolaemus wagleri venom has unique characteristics compared to other pit vipers:

  • It is only weakly pseudo-procoagulant

  • It clots fibrinogen with negligible net anticoagulant effect

  • It contains abundant neurotoxic peptides (Waglerins) that cause neurotoxic envenomation in mice

Research methodologies to explore this relationship might include:

  • Tissue-specific expression analysis: Compare MT-ND4 expression levels in venom gland tissue versus other tissues to identify potential upregulation associated with venom production.

  • Mitochondrial function assays: Examine whether venom gland mitochondria exhibit specialized properties that may be linked to MT-ND4 variants.

  • Metabolic flux analysis: Trace carbon and energy flow in venom gland cells under various conditions to understand how mitochondrial function supports toxin synthesis.

  • Comparative analysis across ontogeny: Investigate potential differences in MT-ND4 expression or activity between juvenile and adult specimens, particularly given the significant morphological changes that occur during development.

What techniques can be employed to study MT-ND4 interactions with other respiratory chain components?

Understanding the protein-protein interactions of MT-ND4 within the respiratory chain requires sophisticated biochemical and biophysical approaches:

  • Co-immunoprecipitation studies: Use antibodies against the His-tag of recombinant MT-ND4 to pull down interaction partners from solubilized mitochondrial preparations.

  • Cross-linking mass spectrometry: Apply chemical cross-linking followed by mass spectrometry to identify proteins in close proximity to MT-ND4 within the respiratory complex.

  • Blue native PAGE: Employ non-denaturing electrophoresis to analyze intact respiratory complexes containing MT-ND4.

  • Surface plasmon resonance: Measure binding kinetics between immobilized MT-ND4 and other purified respiratory chain components.

  • Cryo-electron microscopy: Visualize the structural organization of MT-ND4 within the larger Complex I assembly to determine interaction interfaces.

Table 1: Recommended experimental approaches for studying MT-ND4 interactions

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIdentification of interaction partnersCan detect transient interactionsMay identify non-specific binding
Cross-linking MSSpatial relationship mappingProvides distance constraintsComplex data interpretation
Blue native PAGEAnalysis of intact complexesPreserves native interactionsLimited resolution
Surface plasmon resonanceBinding kineticsQuantitative binding parametersRequires purified components
Cryo-EMStructural visualizationDirect observation of interactionsTechnically challenging

What are the optimal conditions for functional assays of recombinant MT-ND4?

Designing robust functional assays for recombinant MT-ND4 requires careful consideration of several parameters:

  • Buffer composition: Phosphate buffers (pH 7.4-7.8) supplemented with appropriate detergents to maintain protein solubility without disrupting activity.

  • Substrate concentrations: Titration of NADH concentrations (typically 50-200 μM) to determine Km values and optimal assay conditions.

  • Electron acceptors: Natural (ubiquinone) or artificial electron acceptors (such as ferricyanide) can be used, with optimization required for each.

  • Temperature considerations: Given that Tropidolaemus wagleri is a tropical species, activity assays at 25-30°C may better reflect physiological conditions compared to standard 37°C assays.

  • Activity measurement approaches:

    • Spectrophotometric monitoring of NADH oxidation (decreasing absorbance at 340 nm)

    • Oxygen consumption using polarography or optical sensors

    • Measurement of proton translocation using pH-sensitive probes

  • Reconstitution systems: Incorporation of purified MT-ND4 into liposomes to assess transmembrane activity.

How can researchers overcome challenges in expressing and purifying functional MT-ND4?

The expression and purification of transmembrane proteins like MT-ND4 present significant technical challenges. Recommended approaches include:

  • Expression systems optimization:

    • While E. coli is commonly used , consider alternative expression hosts such as yeast or insect cells that may better accommodate membrane proteins

    • Utilize specialized E. coli strains designed for membrane protein expression (C41, C43)

    • Test induction conditions (temperature, inducer concentration, duration)

  • Solubilization strategies:

    • Screen detergents of varying types (non-ionic, zwitterionic) and critical micelle concentrations

    • Consider detergent mixtures or novel solubilization agents like SMALPs (styrene-maleic acid lipid particles)

  • Purification refinement:

    • Leverage the N-terminal 10xHis tag for initial purification

    • Implement multi-step purification including ion exchange and size exclusion chromatography

    • Optimize imidazole concentrations and gradients during IMAC purification

  • Functional verification:

    • Develop activity assays tailored to partially purified protein

    • Consider reconstitution into nanodiscs or liposomes to stabilize function

    • Implement quality control for protein homogeneity using techniques like analytical ultracentrifugation

Table 2: Troubleshooting guide for MT-ND4 expression and purification

ChallengePotential CausesSolutions
Low expression yieldProtein toxicity, inclusion body formationLower induction temperature, reduce inducer concentration, use specialized host strains
Poor solubilizationInadequate detergent selectionScreen multiple detergents, optimize detergent:protein ratio
Loss of activity during purificationDetergent-induced conformational changesTest milder detergents, add stabilizing agents (glycerol, specific lipids)
AggregationHydrophobic interactionsInclude appropriate detergent in all buffers, consider additives like glycerol
HeterogeneityMultiple conformational statesOptimize buffer conditions, consider additional purification steps

What controls are essential for experiments utilizing recombinant MT-ND4?

Rigorous experimental design requires appropriate controls to ensure reliable results when working with recombinant MT-ND4:

  • Negative controls:

    • Heat-denatured MT-ND4 (incubation at 95°C for 10 minutes)

    • Buffer-only controls matched for all components except protein

    • Irrelevant protein of similar size with the same tag system

  • Positive controls:

    • Commercial mitochondrial Complex I preparations (when applicable)

    • Well-characterized NADH dehydrogenase from model organisms

  • Specificity controls:

    • Specific inhibitors of Complex I (rotenone, piericidin A)

    • Site-directed mutants of key catalytic residues

  • Technical validation:

    • Verification of protein identity by mass spectrometry

    • Assessment of purity by SDS-PAGE and Western blotting

    • Confirmation of proper folding by circular dichroism

  • Storage stability controls:

    • Fresh preparations compared with stored samples to assess activity retention

    • Monitoring of activity under recommended storage conditions (4°C for short-term; -20°C or -80°C for extended storage)

How does MT-ND4 sequence variation correlate with the unique biology of Tropidolaemus wagleri?

The MT-ND4 sequence from Tropidolaemus wagleri can provide insights into the evolutionary adaptations of this species:

  • Sequence-function relationships: Analyze how specific amino acid residues in the MT-ND4 sequence might relate to the unique physiological characteristics of T. wagleri, including its substantial sexual dimorphism where females grow significantly larger (92-100 cm) than males (52-60 cm) .

  • Metabolic adaptation signatures: Examine whether the MT-ND4 sequence contains signatures of selection that might correlate with the species' arboreal lifestyle and specialized predation strategies.

  • Comparative analysis framework:

    • Compare T. wagleri MT-ND4 with homologs from closely related species

    • Identify positions under positive selection that might indicate functional adaptation

    • Map sequence variations to structural models to assess potential functional impacts

  • Integration with ecological data: Correlate sequence features with the snake's habitat preferences, as T. wagleri is primarily found in wet lowland forest areas .

What insights might MT-ND4 provide about mitochondrial function in relation to venom production energetics?

The production and maintenance of venom is energetically costly, potentially imposing specific demands on mitochondrial function:

  • Tissue-specific expression patterns: Investigate whether MT-ND4 expression levels or isoforms differ between venom gland tissue and other tissues, potentially reflecting specialized energy requirements for toxin synthesis.

  • Metabolic adaptation hypothesis: Test whether mitochondrial efficiency correlates with the unique venom composition of T. wagleri, which contains neurotoxic Waglerin peptides .

  • Sex-specific variations: Given the marked sexual dimorphism in T. wagleri, examine whether males and females exhibit differences in MT-ND4 sequence or expression that might relate to different energetic demands.

  • Developmental considerations: Investigate potential shifts in MT-ND4 expression or function during ontogeny, particularly during the significant morphological transitions from juvenile to adult forms .

How can structural analysis of MT-ND4 inform our understanding of snake mitochondrial adaptation?

Structural biology approaches can provide mechanistic insights into MT-ND4 function:

  • Homology modeling: Generate structural models based on the T. wagleri MT-ND4 sequence using resolved structures of homologous proteins as templates.

  • Functional domain mapping: Identify conserved and variable regions that might relate to specific aspects of electron transport function or proton pumping.

  • Comparative structural analysis: Contrast structural features with those of MT-ND4 proteins from snake species with different ecological niches and metabolic demands.

  • Integration with functional data: Map functional properties (substrate affinity, catalytic efficiency) to structural features to establish structure-function relationships.

  • Molecular dynamics simulations: Simulate protein dynamics under various conditions to understand conformational changes during catalysis.

What emerging technologies might advance MT-ND4 research?

Several cutting-edge approaches hold promise for deepening our understanding of MT-ND4:

  • Cryo-electron microscopy: High-resolution structural determination of MT-ND4 within native mitochondrial membranes or reconstituted systems.

  • Single-molecule techniques: Observing conformational changes and catalytic events in individual MT-ND4 molecules.

  • CRISPR/Cas9-mediated genome editing: Creating model systems with modified MT-ND4 to examine functional consequences in vivo.

  • Advanced computational approaches: Using machine learning and AI to predict functional properties from sequence data and identify potential regulatory interactions.

  • Integrative omics: Combining proteomics, metabolomics, and transcriptomics to understand MT-ND4 in the broader context of cellular metabolism.

What interdisciplinary approaches might yield new insights about MT-ND4 function?

Bridging diverse fields could generate novel perspectives on MT-ND4 biology:

  • Evolutionary physiology: Correlating MT-ND4 variations with differences in metabolic rates across snake species, particularly in relation to habitat, behavior, and thermal preferences.

  • Toxinology and bioenergetics: Exploring how mitochondrial function supports the energetically demanding process of venom production and regeneration.

  • Comparative genomics and ecology: Examining MT-ND4 sequence evolution in the context of habitat shifts and environmental adaptation in the Tropidolaemus genus.

  • Developmental biology: Investigating potential changes in mitochondrial function during the dramatic morphological transformations seen in T. wagleri from juvenile to adult forms, especially given the marked sexual dimorphism .

  • Conservation biology: Understanding how mitochondrial adaptations might influence species resilience to environmental changes and habitat disruption.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.