Recombinant Trypanosoma brucei brucei Phosphatidylcholine:ceramide cholinephosphotransferase 4 (SLS4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SLS4; Tb09.211.1000; Phosphatidylcholine:ceramide cholinephosphotransferase 4; Ethanolamine-phosphorylceramide synthase; EPC synthase; Sphingolipid synthase; Sphingomyelin synthase; SM synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Trypanosoma brucei brucei (strain 927/4 GUTat10.1)
Target Names
SLS4
Target Protein Sequence
MISYPFFSLSPPGLVPPPMAVPPVEMYSGSFWNRMRKPLPLRTQVIRFTVVFVIVSFILA VALQITHERMPDPKVTKPLPDLGFELLTKVPGMYVLADCCIGFLNILSVFTAFKLYLLHR HCVGSGEPELPCNIPGVSRFFLSVWLCKENCRIELRNVHTIAWIRFITSYALLLLFRSVV IVMTSLPAPDDLCQDPPKIENPVKNVILTVLTAGGGSIHCGDLMYSGHTVILTLHLMFHW IYGAMVHWSFRPVVTVVAIFGYYCIVASRFHYTDDVLVAIYLTIATFIAVGHNADGAPWQ LQLFIRWLPCCGANSREMTEDSQPVMVAFKSEELDEMNGVLEGRQKKHGGVGDGEALMFK CGAYV
Uniprot No.

Target Background

Function
This bidirectional lipid cholinephosphotransferase interconverts phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG). The reaction direction is determined by the relative concentrations of DAG and ceramide as phosphocholine acceptors. It specifically recognizes the choline head group of the substrate and requires two fatty chains on the choline-P donor for efficient substrate recognition. This enzyme doesn't function solely as an SM synthase. Its essentiality to the viability of the pathogenic bloodstream form of *Trypanosoma brucei brucei* highlights its potential as a drug target.
Database Links
Protein Families
Sphingomyelin synthase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the role of Phosphatidylcholine:ceramide cholinephosphotransferase 4 in the SLS pathway?

Phosphatidylcholine:ceramide cholinephosphotransferase 4 (SLS4) is part of the Spliced Leader RNA Silencing (SLS) pathway in Trypanosoma brucei. This pathway is activated in response to stress conditions that affect protein processing across multiple cellular compartments. SLS activation is mediated by a serine-threonine kinase, PK3, which translocates from the endoplasmic reticulum (ER) to the nucleus where it phosphorylates the TATA-binding protein TRF4. This phosphorylation leads to shutoff of SL RNA transcription, ultimately triggering programmed cell death . The enzyme SLS4 specifically functions in phospholipid metabolism, catalyzing the transfer of phosphocholine from phosphatidylcholine to ceramide, which appears to be critical for maintaining membrane integrity during cellular stress responses.

How does SLS4 differ between Trypanosoma subspecies?

While specific comparative data for SLS4 across Trypanosoma subspecies is limited, research indicates that the SLS pathway may function differently between subspecies. For example, the SCN (suprachiasmatic nucleus) appears more susceptible to T. b. gambiense than to T. b. brucei infection . Additionally, differences in protein secretion patterns have been observed between subspecies, such as T. b. gambiense's ability to excrete/secrete proteins like Translationally Controlled Tumor Protein (TCTP) . These subspecies-specific differences suggest that SLS4 may also exhibit functional variations across Trypanosoma brucei subspecies, potentially contributing to their distinct pathogenicity profiles and host-parasite interactions.

What are the optimal conditions for expressing recombinant Trypanosoma brucei SLS4?

The optimal expression system for recombinant Trypanosoma proteins can be modeled after successful approaches used for related proteins. Based on methodologies used for other Trypanosoma proteins, a baculovirus expression system offers significant advantages. For example, the Tbg tctp gene was successfully expressed using the baculovirus vector pAcGHLT-A in Spodoptera frugicola (strain 9) insect cells . For SLS4, similar expression strategies can be employed with the following protocol modifications:

  • Gene synthesis and codon optimization for the expression host

  • Cloning into a baculovirus vector with an appropriate purification tag

  • Transfection into insect cells (Sf9 or High Five™)

  • Expression at 27°C for 72-96 hours post-infection

  • Purification via affinity chromatography followed by size exclusion chromatography

These conditions should be optimized specifically for SLS4 based on initial expression trials and activity assays.

What purification strategies are most effective for obtaining active SLS4 enzyme?

Purification of membrane-associated enzymes like phosphatidylcholine:ceramide cholinephosphotransferase requires specialized approaches:

  • Membrane Fraction Isolation: Initial separation of membrane fractions using ultracentrifugation (100,000×g for 1 hour) to isolate the enzyme from its native environment.

  • Detergent Solubilization: Carefully selected detergents (e.g., n-dodecyl-β-D-maltoside or digitonin at 0.5-1%) that preserve enzyme structure and activity.

  • Affinity Chromatography: Using tags such as His6 or GST, with detergent-containing buffers throughout purification.

  • Size Exclusion Chromatography: For final polishing and buffer exchange to remove aggregates.

  • Activity Preservation: Addition of specific phospholipids (particularly phosphatidylcholines with unsaturated fatty acids) in the final buffer, as these lipids are approximately 10-fold more effective substrates than saturated species and may help maintain enzyme stability and function .

Enzyme activity should be monitored throughout purification using a choline phosphotransferase assay to ensure the protein remains functional.

How can SLS4 be used as a target for developing novel antiparasitic compounds?

SLS4, as a critical enzyme in the SLS pathway, represents a promising target for antiparasitic drug development based on several strategic considerations:

  • Pathway Essentiality: The SLS pathway is vital for trypanosomes but absent in mammalian hosts, offering selective targeting potential. Interference with this pathway leads to SL RNA transcription shutoff and programmed cell death .

  • Structural Analysis Approach:

    • Generate high-resolution structures of SLS4 through X-ray crystallography or cryo-EM

    • Identify the active site and substrate binding pockets

    • Perform in silico screening of compound libraries against these structures

  • Enzyme Inhibition Strategy:

    • Develop assays measuring phosphocholine transfer activity

    • Screen for compounds that disrupt the ping-pong reaction mechanism observed in related enzymes

    • Focus on compounds that exploit the asymmetric orientation of the enzyme in the membrane

  • Validation Protocol:

    Validation StepMethodologyExpected Results
    Initial screeningRecombinant enzyme inhibition assayIC50 < 10 μM
    Cellular validationGrowth inhibition of cultured parasitesEC50 < 5 μM
    Mechanism confirmationWestern blot for TRF4 phosphorylationIncreased phosphorylation
    Specificity assessmentMammalian cell toxicitySelectivity index > 50
    Resistance potentialSerial passage with sub-lethal dosesGenetic analysis of resistant strains
  • Combination Therapy Development: Test with existing drugs like suramin or melarsoprol to identify synergistic combinations targeting multiple essential pathways.

What is the relationship between SLS4 activity and the induction of programmed cell death in Trypanosoma brucei?

The relationship between SLS4 activity and programmed cell death (PCD) in Trypanosoma brucei involves a complex signaling cascade within the SLS pathway:

  • Activity Regulation: SLS4 functions in phospholipid metabolism, particularly in membrane remodeling during stress conditions. When this enzyme is compromised, either through genetic silencing or chemical inhibition, it likely contributes to ER stress and membrane dysfunction.

  • SLS Pathway Activation: Disruption of protein processing in the ER, including functions potentially related to SLS4, activates the SLS pathway through the PK3 kinase. This kinase becomes phosphorylated on multiple sites and translocates from the ER to the nucleus .

  • Transcriptional Consequences: In the nucleus, PK3 phosphorylates the TATA-binding protein TRF4 at Ser35, leading to SL RNA transcription shutoff. This is characterized by a shift in TRF4 migration pattern on gels and its diffuse accumulation in the nucleus .

  • Cell Death Progression: Following SL RNA transcription shutoff, trans-splicing of mRNAs is inhibited, leading to global translation arrest and the induction of PCD, similar to what has been observed with silencing of other essential genes like bip and crt .

  • Differential Sensitivity: Interestingly, research suggests varying severity of SLS activation depending on the specific stress or disruption. For example, silencing of timrhom1 (involved in mitochondrial protein import) induces SLS but to a lesser extent than sec63 silencing , suggesting compartment-specific thresholds for SLS activation.

This relationship provides potential for targeted therapeutic interventions that could selectively induce PCD in the parasite through SLS4 modulation.

What controls should be included when designing experiments to assess SLS4 function in vitro?

When designing rigorous experiments to assess SLS4 function in vitro, the following controls are essential:

  • Enzyme Activity Controls:

    • Positive Control: Commercially available or well-characterized phosphocholine transferase

    • Negative Control: Heat-inactivated SLS4 (95°C for 10 minutes)

    • No-substrate Control: Reaction mixture lacking either phosphatidylcholine or ceramide

  • Substrate Specificity Controls:

    • Lipid Variation Panel: Test multiple phosphatidylcholines with varying fatty acid compositions (saturated vs. unsaturated) to confirm the observation that unsaturated species are approximately 10-fold more effective substrates

    • Competitive Substrate Control: Include structurally similar lipids to assess specificity

  • Reaction Condition Controls:

    • Temperature Series: Perform reactions at multiple temperatures (25°C, 37°C, 42°C) to validate the activation energy (approximately 17.2 kcal/mol for related enzymes)

    • pH Series: Assess activity across a pH range (6.0-8.0) to determine optimal conditions

    • Divalent Cation Dependency: Include reactions with EDTA and various concentrations of Mg²⁺ and Ca²⁺

  • Mechanism Validation Controls:

    • Enzyme Concentration Series: Confirm linear relationship between enzyme concentration and reaction rate

    • Time Course Analysis: Establish linear range of the reaction for kinetic measurements

    • Inhibitor Controls: Known inhibitors of phospholipid metabolism (e.g., sphingomyelinase inhibitors)

  • Recombinant Protein Quality Controls:

    • SDS-PAGE: Verify protein purity and integrity

    • Mass Spectrometry: Confirm protein identity and post-translational modifications

    • Circular Dichroism: Assess proper protein folding

These controls ensure reliable and interpretable results when characterizing SLS4 enzyme activity and mechanism.

How should researchers design genetic manipulation experiments to study SLS4 function in vivo?

Designing genetic manipulation experiments for studying SLS4 function in vivo requires careful consideration of several factors:

  • Selection of Genetic Modification Strategy:

    ApproachAdvantagesLimitationsBest Application
    RNAi knockdownTunable, reversibleIncomplete silencingInitial phenotype assessment
    CRISPR/Cas9 knockoutComplete gene eliminationLethal if essentialNon-essential genes or conditional systems
    Conditional knockoutTemporal controlTechnical complexityEssential genes
    Point mutationsStructure-function insightsSubtle phenotypesMechanistic studies
    Epitope taggingLocalization studiesPotential interference with functionProtein interaction studies
  • Experimental Design for Inducible Systems:

    • Establish baseline expression levels before induction

    • Use tetracycline-responsive promoters for tight regulation

    • Implement time-course experiments (24, 48, 72 hours post-induction)

    • Monitor multiple parameters: growth rate, cell morphology, and specific molecular markers

  • Critical Phenotypic Assessments:

    • Monitoring TRF4 phosphorylation and localization using immunofluorescence

    • Measuring SL RNA levels by primer extension analysis

    • Assessing membrane integrity and phospholipid composition

    • Evaluating ER stress markers and mitochondrial function

    • Quantifying programmed cell death using flow cytometry with annexin V and propidium iodide

  • In Vivo Model Considerations:

    • Mouse models for bloodstream form studies

    • Tsetse fly infections for cyclic transmission studies

    • Evaluate bacterial interactions in the tsetse gut, as observed with other trypanosome proteins

  • Rescue Experiments:

    • Complementation with wild-type gene to confirm phenotype specificity

    • Expression of mutant variants to identify critical residues

    • Heterologous expression of SLS4 orthologs from different Trypanosoma species to assess functional conservation

These experimental approaches provide a comprehensive framework for understanding SLS4 function in the complex biology of Trypanosoma brucei.

How can researchers interpret conflicting results when studying SLS4 in different Trypanosoma life stages?

When faced with conflicting results across different Trypanosoma life stages (procyclic, metacyclic, bloodstream forms), researchers should consider:

  • Life Stage-Specific Metabolism:

    • Bloodstream forms rely heavily on glycolysis and have repressed mitochondrial function

    • Procyclic forms have active mitochondria and utilize amino acids as energy sources

    • These fundamental metabolic differences may affect SLS4 function and importance

  • Systematic Validation Approach:

    • Repeat experiments with standardized protocols across life stages

    • Use multiple methodologies to verify the same endpoint (e.g., both Western blot and immunofluorescence for protein levels)

    • Implement synchronized cultures to minimize cell cycle variation effects

  • Quantitative Analysis Framework:

    • Apply statistical methods appropriate for biological variation

    • Use time-course experiments rather than single time points

    • Consider dose-response relationships rather than single concentrations

  • Molecular Context Evaluation:

    • Assess expression levels of interacting partners across life stages

    • Examine post-translational modifications that might differ between stages

    • Consider subcellular localization changes that might affect function

  • Technical Considerations:

    • Different life stages may require modified lysis conditions

    • Membrane protein extraction efficiency may vary between stages

    • Antibody accessibility to epitopes might differ due to stage-specific protein associations

When interpreting apparently conflicting results, researchers should consider that SLS4 may have distinct functions in different life stages, similar to how SCN susceptibility differs between T. b. gambiense and T. b. brucei infections , reflecting the parasite's complex life cycle adaptations.

What troubleshooting strategies should be employed when recombinant SLS4

expression yields inactive enzyme?

When recombinant SLS4 expression yields inactive enzyme, researchers should implement the following systematic troubleshooting strategies:

  • Expression System Optimization:

    • Try alternative expression hosts (E. coli, yeast, mammalian cells) beyond insect cells

    • Test different promoters and fusion tags (N-terminal vs. C-terminal)

    • Optimize codon usage for the expression host

    • Explore temperature reduction during expression (16-20°C) to improve folding

  • Protein Solubilization and Purification Refinement:

    • Screen multiple detergents at varying concentrations for optimal membrane protein extraction

    • Test native phospholipid addition during solubilization

    • Include stabilizing agents such as glycerol (10-20%) or specific lipids in purification buffers

    • Consider nanodiscs or liposome reconstitution for maintaining native-like environment

  • Enzyme Activity Restoration Protocol:

    • Add back endogenous phospholipids, particularly unsaturated phosphatidylcholines, which can be 10-fold more effective substrates than saturated species

    • Test different buffer compositions, especially varying pH and ionic strength

    • Add potential cofactors (ATP, Mg²⁺, Mn²⁺, Ca²⁺) that might be required for activity

    • Explore reducing conditions (DTT or β-mercaptoethanol) to maintain critical thiol groups

  • Structural Integrity Assessment:

    • Analyze protein by circular dichroism to verify secondary structure

    • Use thermal shift assays to identify stabilizing conditions

    • Employ limited proteolysis to check for proper folding

    • Consider mass spectrometry to verify post-translational modifications

  • Activity Assay Refinement:

    • Develop more sensitive detection methods

    • Extend incubation times for slow enzymatic reactions

    • Optimize substrate concentrations based on Km values

    • Include positive controls from related phosphotransferases

The enzyme kinetics of phosphatidylcholine:ceramide cholinephosphotransferase follows a ping-pong reaction mechanism with formation of an enzyme-bound intermediate of the phosphocholine group . This mechanistic insight can guide the development of optimized activity assays and help identify critical conditions for recovering enzyme function.

How does SLS4 function integrate with the broader Spliced Leader RNA Silencing pathway in parasite stress response?

SLS4 functions as part of an integrated stress response network in trypanosomes that connects membrane homeostasis with the unique RNA processing mechanisms of these parasites:

  • Pathway Integration Mechanism:

    • SLS4, as a phosphatidylcholine:ceramide cholinephosphotransferase, is involved in membrane phospholipid remodeling

    • Disruptions in membrane integrity or composition are detected as cellular stress

    • This stress activates the SLS pathway through PK3 kinase, which translocates from the ER to the nucleus

    • In the nucleus, PK3 phosphorylates TRF4 at Ser35, causing transcription shutoff of SL RNA

    • The reduction in SL RNA prevents trans-splicing of mRNAs, leading to programmed cell death

  • Stress Response Hierarchy:

    • SLS can be triggered by disruptions in multiple cellular compartments

    • ER-resident chaperones (BiP, calreticulin), sulfhydryl oxidases (ERO1, QSOX), and even mitochondrial protein import factors (TIMRHOM1) can induce SLS when depleted

    • This suggests SLS4 functions within a broader cellular surveillance system that detects proteostasis failures

  • Temporal Dynamics:

    • SLS activation follows a specific sequence: stress detection → PK3 phosphorylation → nuclear translocation → TRF4 phosphorylation → SL RNA reduction → global translation arrest → programmed cell death

    • This temporal progression allows for potential adaptation to mild stress while committing to cell death under severe conditions

  • Evolutionary Context:

    • The SLS pathway represents a unique parasite-specific adaptation that links RNA processing to stress responses

    • Unlike the Unfolded Protein Response in other eukaryotes, trypanosomes have evolved this alternative mechanism to cope with proteostatic stress

Understanding SLS4's role in this integrated pathway provides insights into trypanosome-specific biology that may be exploited for targeted therapeutic interventions.

What is the relationship between SLS4 function and trypanosome interactions with the host immune system?

The relationship between SLS4 function and trypanosome-host immune interactions involves multiple dimensions of parasite survival and immune evasion:

  • Membrane Composition and Antigen Presentation:

    • SLS4, as a phosphatidylcholine:ceramide cholinephosphotransferase, influences membrane lipid composition

    • Membrane lipids are critical for the proper display and shedding of variant surface glycoproteins (VSGs), the primary antigenic determinants

    • Alterations in SLS4 activity may affect VSG trafficking and display, potentially modifying immune recognition patterns

  • Stress Response Coordination:

    • Host immune attacks, particularly through oxidative burst mechanisms, induce stress in trypanosomes

    • The SLS pathway, which can be activated by various cellular stresses , likely serves as a sensor for immune-mediated damage

    • Moderate stress may induce adaptive responses, while severe immune attack could trigger SLS-mediated programmed cell death

  • Parasite-Microbiome Interactions:

    • Trypanosoma proteins like TCTP have been shown to bind to and affect the growth of bacteria in the tsetse fly gut

    • Similar interactions may occur between SLS4-influenced membrane components and host microbiome

    • These interactions could modulate host immunity through altered microbiome composition

  • Experimental Evidence From Related Systems:

    • In T. b. gambiense infections, inflammatory mediators like tumor necrosis factor-α and interferon-γ can disrupt synaptic machinery of SCN neurons

    • Similar inflammatory signaling may affect SLS4 function in the parasite through stress response pathways

    • This creates a bidirectional relationship between parasite stress responses and host immunity

  • Therapeutic Implications:

    • Understanding how SLS4 functions under immune pressure could reveal vulnerabilities

    • Combination therapies targeting both SLS4 and enhancing specific immune responses might offer synergistic effects

    • Vaccines targeting SLS4 or related membrane components might disrupt the parasite's ability to adapt to immune challenges

This complex relationship between SLS4 function and host immunity highlights the sophisticated adaptations of trypanosomes to their challenging life cycle environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.